Active Recombinant Human TNFRSF18 protein, hFc-tagged

• Cat.No.: TNFRSF18-4602H
• Product Overview: Recombinant Human TNFRSF18 protein(Q9Y5U5)(26-161aa), fused to C-terminal hFc tag, was expressed in Mammalian cell.

Specification

• Source: Mammalian cell
• Species: Human
• Tag: Fc
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Bio-activity: Measured by its binding ability in a functional ELISA. Immobilized TNFRSF18 at 2 μg/ml can bind TNFSF18, the EC50 is 2.565 to 2.940 ng/ml. Human TNFRSF18 protein hFc tag captured on COOH chip can bind Human TNFSF18 protein hFc and Flag tag with an affinity constant of 38.5 nM as detected by LSPR Assay.
• Molecular Mass: 40.8 kDa
• Protein length: 26-161aa
• AA Sequence: QRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTFSGGHEGHCKPWTDCTQFGFLTVFPGNKTHNAVCVPGSPPAEP
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Purity: Greater than 92% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: TNFRSF18 tumor necrosis factor receptor superfamily, member 18 [ Homo sapiens ]
• Official Symbol: TNFRSF18
• Synonyms: TNFRSF18; tumor necrosis factor receptor superfamily, member 18; tumor necrosis factor receptor superfamily member 18; AITR; CD357; GITR; activation-inducible TNFR family receptor; glucocorticoid-induced TNFR-related protein; TNF receptor superfamily activation-inducible protein; GITR-D
• Gene ID: 8784
• mRNA Refseq: NM_004195
• Protein Refseq: NP_004186
• MIM: 603905
• UniProt ID: Q9Y5U5