Active Recombinant Human TNFRSF18 protein, hFc-tagged
Cat.No. : | TNFRSF18-4602H |
Product Overview : | Recombinant Human TNFRSF18 protein(Q9Y5U5)(26-161aa), fused to C-terminal hFc tag, was expressed in Mammalian cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Fc |
Protein Length : | 26-161aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Bio-activity : | Measured by its binding ability in a functional ELISA. Immobilized TNFRSF18 at 2 μg/ml can bind TNFSF18, the EC50 is 2.565 to 2.940 ng/ml. Human TNFRSF18 protein hFc tag captured on COOH chip can bind Human TNFSF18 protein hFc and Flag tag with an affinity constant of 38.5 nM as detected by LSPR Assay. |
Molecular Mass : | 40.8 kDa |
AA Sequence : | QRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTFSGGHEGHCKPWTDCTQFGFLTVFPGNKTHNAVCVPGSPPAEP |
Endotoxin : | Less than 1.0 EU/ug as determined by LAL method. |
Purity : | Greater than 92% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | TNFRSF18 tumor necrosis factor receptor superfamily, member 18 [ Homo sapiens ] |
Official Symbol | TNFRSF18 |
Synonyms | TNFRSF18; tumor necrosis factor receptor superfamily, member 18; tumor necrosis factor receptor superfamily member 18; AITR; CD357; GITR; activation-inducible TNFR family receptor; glucocorticoid-induced TNFR-related protein; TNF receptor superfamily activation-inducible protein; GITR-D; |
Gene ID | 8784 |
mRNA Refseq | NM_004195 |
Protein Refseq | NP_004186 |
MIM | 603905 |
UniProt ID | Q9Y5U5 |
◆ Recombinant Proteins | ||
Tnfrsf18-6754M | Recombinant Mouse Tnfrsf18 protein, His-tagged | +Inquiry |
TNFRSF18-662M | Recombinant Mouse TNFRSF18 Protein | +Inquiry |
TNFRSF18-301498H | Recombinant Human TNFRSF18 protein, GST-tagged | +Inquiry |
TNFRSF18-1481R | Recombinant Rat TNFRSF18 protein, Fc-tagged | +Inquiry |
TNFRSF18-554H | Recombinant Human TNFRSF18, Fc tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF18-1245RCL | Recombinant Rat TNFRSF18 cell lysate | +Inquiry |
TNFRSF18-1143HCL | Recombinant Human TNFRSF18 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNFRSF18 Products
Required fields are marked with *
My Review for All TNFRSF18 Products
Required fields are marked with *
0
Inquiry Basket