Recombinant Full Length Upf0053 Protein Mb2387C (Mb2387C) Protein, His-Tagged
Cat.No. : | RFL30690MF |
Product Overview : | Recombinant Full Length UPF0053 protein Mb2387c (Mb2387c) Protein (P67131) (1-435aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycobacterium Bovis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-435) |
Form : | Lyophilized powder |
AA Sequence : | MTGYYQLLGSIVLIGLGGLFAAIDAAISTVSPARVDELVRDQRPGAGSLRKVMADRPRYV NLVVLLRTSCEITATALLVVFIRYHFSMVWGLYLAAGIMVLASFVVVGVGPRTLGRQNAY SISLATALPLRLISWLLMPISRLLVLLGNALTPGRGFRNGPFASEIELREVVDLAQQRGV VAADERRMIESVFELGDTPAREVMVPRTEMIWIESDKTAGQAMTLAVRSGHSRIPVIGEN VDDIVGVVYLKDLVEQTFCSTNGGRETTVARVMRPAVFVPDSKPLDALLREMQRDRNHMA LLVDEYGAIAGLVSIEDVLEEIVGEIADEYDQAETAPVEDLGDKRFRVSARLPIEDVGEL YGVEFDDDLDVDTVGGLLALELGRVPLPGAEVISHGLRLHAEGGTDHRGRVRIGTVLLSP AEPDGADDEEADHPG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BQ2027_MB2387C |
Synonyms | BQ2027_MB2387C; UPF0053 protein Mb2387c |
UniProt ID | P67131 |
◆ Recombinant Proteins | ||
ADCYAP1-0497H | Recombinant Human ADCYAP1 Protein (Ile17-Leu176), N-GST-tagged | +Inquiry |
SSP-RS06560-0307S | Recombinant Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 SSP_RS06560 protein, His-tagged | +Inquiry |
LCMT1-1359Z | Recombinant Zebrafish LCMT1 | +Inquiry |
ACADSB-240M | Recombinant Mouse ACADSB Protein, His (Fc)-Avi-tagged | +Inquiry |
NRN1-4215C | Recombinant Chicken NRN1 | +Inquiry |
◆ Native Proteins | ||
FGG -41B | Native Bovine Fibrinogen, FITC Labeled | +Inquiry |
PPBP-30279TH | Native Human PPBP | +Inquiry |
IgG-332S | Native Swine IgG | +Inquiry |
IgG-328S | Native Swine Gamma Globulin Fraction | +Inquiry |
R-PE-004R | Native Red Fluorescent Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTGIR-2710HCL | Recombinant Human PTGIR 293 Cell Lysate | +Inquiry |
Esophagus-640B | Bovine Esophagus Lysate, Total Protein | +Inquiry |
GFRA1-966CCL | Recombinant Canine GFRA1 cell lysate | +Inquiry |
SLC39A9-1716HCL | Recombinant Human SLC39A9 293 Cell Lysate | +Inquiry |
SERPINF1-2673MCL | Recombinant Mouse SERPINF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BQ2027_MB2387C Products
Required fields are marked with *
My Review for All BQ2027_MB2387C Products
Required fields are marked with *
0
Inquiry Basket