Recombinant Full Length Upf0053 Inner Membrane Protein Ytfl(Ytfl) Protein, His-Tagged
Cat.No. : | RFL21376EF |
Product Overview : | Recombinant Full Length UPF0053 inner membrane protein ytfL(ytfL) Protein (P0AE46) (1-447aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-447) |
Form : | Lyophilized powder |
AA Sequence : | MLNSILVILCLIAVSAFFSMSEISLAASRKIKLKLLADEGNINAQRVLNMQENPGMFFTV VQIGLNAVAILGGIVGDAAFSPAFHSLFSRYMSAELSEQLSFILSFSLVTGMFILFADLT PKRIGMIAPEAVALRIINPMRFCLYVCTPLVWFFNGLANIIFRIFKLPMVRKDDITSDDI YAVVEAGALAGVLRKQEHELIENVFELESRTVPSSMTPRENVIWFDLHEDEQSLKNKVAE HPHSKFLVCNEDIDHIIGYVDSKDLLNRVLANQSLALNSGVQIRNTLIVPDTLTLSEALE SFKTAGEDFAVIMNEYALVVGIITLNDVMTTLMGDLVGQGLEEQIVARDENSWLIDGGTP IDDVMRVLDIDEFPQSGNYETIGGFMMFMLRKIPKRTDSVKFAGYKFEVVDIDNYRIDQL LVTRIDSKATALSPKLPDAKDKEESVA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ytfL |
Synonyms | paeA; ytfL; c5316; Polyamine export protein |
UniProt ID | P0AE46 |
◆ Recombinant Proteins | ||
RFL22866PF | Recombinant Full Length Burkholderia Xenovorans Upf0060 Membrane Protein Bxeno_B1021(Bxeno_B1021) Protein, His-Tagged | +Inquiry |
IRAK1-5056H | Recombinant Human IRAK1 Protein, GST-tagged | +Inquiry |
XKDF-2395B | Recombinant Bacillus subtilis XKDF protein, His-tagged | +Inquiry |
MAMU-DRA-2470R | Recombinant Rhesus Macaque MAMU-DRA Protein, His (Fc)-Avi-tagged | +Inquiry |
CD274-6775H | Recombinant Human CD274 Molecule, His-tagged | +Inquiry |
◆ Native Proteins | ||
gGT-184B | Active Native Bovine Gamma-Glutamyl Transferase | +Inquiry |
Endoproteinase Lys-C-85L | Native Lysobacter enzymogenes Endoproteinase Lys-C | +Inquiry |
Actin-889P | Native Porcine Actin Protein | +Inquiry |
ctxB-146V | Native Cholera Toxin B | +Inquiry |
Ckmm-167R | Native Rat Creatine Kinase MM | +Inquiry |
◆ Cell & Tissue Lysates | ||
POLH-1392HCL | Recombinant Human POLH cell lysate | +Inquiry |
PBX2-474HCL | Recombinant Human PBX2 lysate | +Inquiry |
RFFL-538HCL | Recombinant Human RFFL lysate | +Inquiry |
CCDC37-155HCL | Recombinant Human CCDC37 lysate | +Inquiry |
INSR-2648HCL | Recombinant Human INSR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ytfL Products
Required fields are marked with *
My Review for All ytfL Products
Required fields are marked with *
0
Inquiry Basket