Recombinant Full Length Upf0053 Inner Membrane Protein Ygdq(Ygdq) Protein, His-Tagged
Cat.No. : | RFL14805EF |
Product Overview : | Recombinant Full Length UPF0053 inner membrane protein ygdQ(ygdQ) Protein (P67128) (1-237aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-237) |
Form : | Lyophilized powder |
AA Sequence : | MLFAWITDPNAWLALGTLTLLEIVLGIDNIIFLSLVVAKLPTAQRAHARRLGLAGAMVMR LALLASIAWVTRLTNPLFTIFSQEISARDLILLLGGLFLIWKASKEIHESIEGEEEGLKT RVSSFLGAIVQIMLLDIIFSLDSVITAVGLSDHLFIMMAAVVIAVGVMMFAARSIGDFVE RHPSVKMLALSFLILVGFTLILESFDIHVPKGYIYFAMFFSIAVESLNLIRNKKNPL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ygdQ |
Synonyms | ygdQ; c3427; UPF0053 inner membrane protein YgdQ |
UniProt ID | P67128 |
◆ Recombinant Proteins | ||
RFL200BF | Recombinant Full Length Bovine Transmembrane Protein 108(Tmem108) Protein, His-Tagged | +Inquiry |
B19R-174 | Active Recombinant Vaccinia virus B19R Protein, Fc-tagged, Biotinylated | +Inquiry |
IRF1B-11762Z | Recombinant Zebrafish IRF1B | +Inquiry |
TBCEL-5969R | Recombinant Rat TBCEL Protein | +Inquiry |
BIRC5-376H | Recombinant Human baculoviral IAP repeat-containing 5, CaM-tagged | +Inquiry |
◆ Native Proteins | ||
Troponin I-11H | Native Human Troponin I protein | +Inquiry |
a-acid glycoprotein-003H | Native Human a-acid glycoprotein Protein | +Inquiry |
IgG-007G | Native Goat Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
CP-8073H | Native Human Plasma Ceruloplasmin | +Inquiry |
Angiostatin-28H | Active Native Human Angiostatin K1-4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PFKFB3-471HCL | Recombinant Human PFKFB3 cell lysate | +Inquiry |
DNAJC7-6870HCL | Recombinant Human DNAJC7 293 Cell Lysate | +Inquiry |
LDLR-2780HCL | Recombinant Human LDLR cell lysate | +Inquiry |
CD86-1971RCL | Recombinant Rat CD86 cell lysate | +Inquiry |
BCKDHB-8492HCL | Recombinant Human BCKDHB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ygdQ Products
Required fields are marked with *
My Review for All ygdQ Products
Required fields are marked with *
0
Inquiry Basket