Recombinant Full Length Uncinocarpus Reesii Putative Dipeptidase Ureg_03382 (Ureg_03382) Protein, His-Tagged
Cat.No. : | RFL32190UF |
Product Overview : | Recombinant Full Length Uncinocarpus reesii Putative dipeptidase UREG_03382 (UREG_03382) Protein (C4JQN7) (1-453aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Uncinocarpus reesii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-453) |
Form : | Lyophilized powder |
AA Sequence : | MSTRDHVKQSPMPVQEGYPRSSKEFSPPSSRSRKRTWVRNLTMSLLIAAGAATFSKYIFP LGSILGAGSLQPIDPHDYAARADRILSTTPLIDGHNDLPYLIRLETKNKIYDHEKLPFEA GLLSHTDAKKIRQGKLGGQFWSVYVECPADPSAGIDDPSWAVRDTLEQIDVAKRLVDEYP DLLEYCETASCARSAFKKGRVGSFLGIEVHDLGVRYITVTHNCDNAFATAASTVAAGKPD HGLTDFGREFVKEMNRLGMLIDLSHVSHQTMRDVLSVTNAPVIFSHSSSYALSKHLRNVP DDVLRTVTKNGGVVMVTFVPLFLKVNDPASVTIHDAVDHILHVAKVAGWDHVGIGSDFDG TAVVPKGLENVSKYPRLVELLLERGVTDEQARKLVGENLLRVWSKAEDIAYAIQASGQKP NEETWSGRKWTAAADIPMPSMFNDSAERRKQLE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | UREG_03382 |
Synonyms | UREG_03382; Putative dipeptidase UREG_03382 |
UniProt ID | C4JQN7 |
◆ Recombinant Proteins | ||
RARG-7425M | Recombinant Mouse RARG Protein, His (Fc)-Avi-tagged | +Inquiry |
SRP14-2955H | Recombinant Human SRP14, GST-tagged | +Inquiry |
SGTB-15050M | Recombinant Mouse SGTB Protein | +Inquiry |
RFL36694DF | Recombinant Full Length Danio Rerio C5A Anaphylatoxin Chemotactic Receptor(C5Ar1) Protein, His-Tagged | +Inquiry |
SRP72-4285R | Recombinant Rhesus Macaque SRP72 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1739H | Active Native Hippeastrum Hybrid (Amaryllis) Lectin Protein | +Inquiry |
GC-198H | Native Human GC-Globulin | +Inquiry |
HBA2-27787TH | Native Human HBA2 | +Inquiry |
S100a6-43M | Native Mouse S100A6 | +Inquiry |
IgE-507H | Native Human IgE protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNPNAT1-5841HCL | Recombinant Human GNPNAT1 293 Cell Lysate | +Inquiry |
CACNG3-270HCL | Recombinant Human CACNG3 cell lysate | +Inquiry |
CCDC53-7761HCL | Recombinant Human CCDC53 293 Cell Lysate | +Inquiry |
TTC23-686HCL | Recombinant Human TTC23 293 Cell Lysate | +Inquiry |
C4orf19-8033HCL | Recombinant Human C4orf19 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All UREG_03382 Products
Required fields are marked with *
My Review for All UREG_03382 Products
Required fields are marked with *
0
Inquiry Basket