Recombinant Full Length Uncharacterized Protein Zk757.1 (Zk757.1) Protein, His-Tagged
Cat.No. : | RFL29739CF |
Product Overview : | Recombinant Full Length Uncharacterized protein ZK757.1 (ZK757.1) Protein (P34679) (1-328aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-328) |
Form : | Lyophilized powder |
AA Sequence : | MIYNNISLNTITTTPLTYRDRITFEFSVHGTCVVFNLFLCIFFICRPHLLRTFKPTIFFV TLGTFVLSLPLFFLQFYLVVFLWSLVEPRYTIAVCTLVKCITSSTTSCAQVLPLAVAIYR YFIVVRNKKMPSWFVVVVHSIISFIFFVIAILNFPLGEFETNDQCAVLRFSKAMEAVRIS LTLGLNLFAVFINVAIYTFVKKYDKRNVDVHRRRVQLTYSMLLQSMIPILVSIPLLVGSF DFYFGSLFELLWGYTLPSGFTSRWYATTFLSPLLTPISSMLSLRTIRHELLSIILSSFLF TGTRKISNLVTKTSKTNVAPHSSDYSSA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ZK757.1 |
Synonyms | ZK757.1; Uncharacterized protein ZK757.1 |
UniProt ID | P34679 |
◆ Recombinant Proteins | ||
DECR2-1224R | Recombinant Rhesus monkey DECR2 Protein, His-tagged | +Inquiry |
NUP210L-10993M | Recombinant Mouse NUP210L Protein | +Inquiry |
CELF2-1404H | Recombinant Human CELF2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PRSS2-7091H | Recombinant Human PRSS2 protein, His & T7-tagged | +Inquiry |
CYSLTR2-1761R | Recombinant Rat CYSLTR2 Protein | +Inquiry |
◆ Native Proteins | ||
APOB-1H | Native Human Apolipoprotein B | +Inquiry |
Thrombin-24H | Active Native Human a-Thrombin | +Inquiry |
FGB-01P | Native Porcine Fibrinogen Protein, FITC Labeled | +Inquiry |
HBsAg-01 | Native Hepatitis B Surface Ag protein | +Inquiry |
CSN-36H | Native Human COP9 signalosome Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MARCH8-4468HCL | Recombinant Human MARCH8 293 Cell Lysate | +Inquiry |
RPL37A-2197HCL | Recombinant Human RPL37A 293 Cell Lysate | +Inquiry |
ATP6V0C-8589HCL | Recombinant Human ATP6V0C 293 Cell Lysate | +Inquiry |
KIF2A-4947HCL | Recombinant Human KIF2A 293 Cell Lysate | +Inquiry |
HeLa-040HCL | Human TNFa Stimulated HeLa Whole Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ZK757.1 Products
Required fields are marked with *
My Review for All ZK757.1 Products
Required fields are marked with *
0
Inquiry Basket