Recombinant Full Length Uncharacterized Protein Ybfb(Ybfb) Protein, His-Tagged
Cat.No. : | RFL28675EF |
Product Overview : | Recombinant Full Length Uncharacterized protein ybfB(ybfB) Protein (P0AAU6) (1-108aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-108) |
Form : | Lyophilized powder |
AA Sequence : | MKYIIFLFRAIWLALSLLILFFSMHRLSLLDSTRDVSELISLMSYGMMVICFPTGIVFFI ALIFIGTVSDIIGVRIDSKYIMAIIIWLYFLSGGYIQWFVLSKRIINK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ybfB |
Synonyms | ybfB; Z0849; Uncharacterized protein YbfB |
UniProt ID | P0AAU6 |
◆ Native Proteins | ||
LDH-15H | Native Human Lactate Dehydrogenase | +Inquiry |
Lectin-1773E | Active Native Erythrina Cristagalli Lectin Protein, Biotinylated | +Inquiry |
F2-274B | Active Native Bovine α-Thrombin | +Inquiry |
COL2A1-16C | Native Chicken COL2A1 Protein | +Inquiry |
LOX-41 | Active Native Lactate Oxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
Soy bean-394P | Plant Plant: Soy bean Lysate | +Inquiry |
Brain-50M | Mouse Brain Membrane Lysate | +Inquiry |
FH-6227HCL | Recombinant Human FH 293 Cell Lysate | +Inquiry |
ACADVL-9111HCL | Recombinant Human ACADVL 293 Cell Lysate | +Inquiry |
ZIC2-166HCL | Recombinant Human ZIC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ybfB Products
Required fields are marked with *
My Review for All ybfB Products
Required fields are marked with *
0
Inquiry Basket