Recombinant Full Length Uncharacterized Protein Rv3789/Mt3897 (Rv3789, Mt3897) Protein, His-Tagged
Cat.No. : | RFL9820HF |
Product Overview : | Recombinant Full Length Uncharacterized protein Rv3789/MT3897 (Rv3789, MT3897) Protein (P64292) (1-121aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-121) |
Form : | Lyophilized powder |
AA Sequence : | MRFVVTGGLAGIVDFGLYVVLYKVAGLQVDLSKAISFIVGTITAYLINRRWTFQAEPSTA RFVAVMLLYGITFAVQVGLNHLCLALLHYRAWAIPVAFVIAQGTATVINFIVQRAVIFRI R |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Uncharacterized protein Rv3789/MT3897 (Rv3789, MT3897) |
UniProt ID | P64292 |
◆ Native Proteins | ||
Thrombin-61M | Active Native Mouse Thrombin | +Inquiry |
Hp-8155M | Native Mouse Serum Haptoglobin | +Inquiry |
BSA-01 | Native Bovine Serum Albumin | +Inquiry |
Lectin-1796L | Active Native Lotus Tetragonolobus Lectin Protein, Agarose bound | +Inquiry |
IgG-339H | Native Horse IgG | +Inquiry |
◆ Cell & Tissue Lysates | ||
C5orf49-121HCL | Recombinant Human C5orf49 lysate | +Inquiry |
TRAF5-819HCL | Recombinant Human TRAF5 293 Cell Lysate | +Inquiry |
MANBAL-4521HCL | Recombinant Human MANBAL 293 Cell Lysate | +Inquiry |
Cerebellum-133R | Rat Cerebellum Tissue Lysate | +Inquiry |
CKAP2-7486HCL | Recombinant Human CKAP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Uncharacterized protein Rv3789/MT3897 (Rv3789, MT3897) Products
Required fields are marked with *
My Review for All Uncharacterized protein Rv3789/MT3897 (Rv3789, MT3897) Products
Required fields are marked with *
0
Inquiry Basket