Recombinant Full Length Uncharacterized Protein Rv2578C/Mt2655 (Rv2578C, Mt2655) Protein, His-Tagged
Cat.No. : | RFL29009HF |
Product Overview : | Recombinant Full Length Uncharacterized protein Rv2578c/MT2655 (Rv2578c, MT2655) Protein (P65023) (1-340aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-340) |
Form : | Lyophilized powder |
AA Sequence : | MRWARQAVAVNGMPVDDGALPGLQRIGLVRSVRAPQFDGITFHEVLCKSALNKVPNAAAL PFRYTVNGYRGCSHACRYCFARPTHEYLDFNPGTDFDTQVVVKTNVAAVLRHELRRPSWR RETVALGTNTDPYQRAEGRYALMPGIIGALAASGTPLSILTKGTLLRRDLPLIAEAAQQV PVSVAVSLAVGDPELHRDVESGTPTPQARLALITAIRAAGLDCHVMVAPVLPQLTDSGEH LDQLLGQIAAAGATGVTVFGLHLRGSTRGWFMCWLARAHPELVSRYRELYRRGPYLPPSY REMLRERVAPLIAKYRLAGDHRPAPPETEAALVPVQATLF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Uncharacterized protein Rv2578c/MT2655 (Rv2578c, MT2655) |
UniProt ID | P65023 |
◆ Native Proteins | ||
GGT1-371P | Native Porcine Gamma-Glutamyltransferase 1 | +Inquiry |
BGLAP-8519B | Native Bovine BGLAP | +Inquiry |
C1QA-26126TH | Native Human C1QA | +Inquiry |
LDH2-8340H | Native Human LDH2 | +Inquiry |
CPD A-036H | Active Native Human Pancreatic Carboxypeptidase A | +Inquiry |
◆ Cell & Tissue Lysates | ||
PBX2-474HCL | Recombinant Human PBX2 lysate | +Inquiry |
CHRNA7-7514HCL | Recombinant Human CHRNA7 293 Cell Lysate | +Inquiry |
MAGEB4-4543HCL | Recombinant Human MAGEB4 293 Cell Lysate | +Inquiry |
GABRE-6059HCL | Recombinant Human GABRE 293 Cell Lysate | +Inquiry |
MED20-4389HCL | Recombinant Human MED20 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Uncharacterized protein Rv2578c/MT2655 (Rv2578c, MT2655) Products
Required fields are marked with *
My Review for All Uncharacterized protein Rv2578c/MT2655 (Rv2578c, MT2655) Products
Required fields are marked with *
0
Inquiry Basket