Recombinant Full Length Uncharacterized Protein Rv1320C/Mt1362(Rv1320C, Mt1362) Protein, His-Tagged
Cat.No. : | RFL21625HF |
Product Overview : | Recombinant Full Length Uncharacterized protein Rv1320c/MT1362(Rv1320c, MT1362) Protein (Q10633) (1-567aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-567) |
Form : | Lyophilized powder |
AA Sequence : | MPSEKATTRHLPGAVETLSPRTGRRPETPAYGSWLLGRVSESPRMRRVRIQGMLTVAILV TNVIGLIVGAMLLTVAFPKPSVILDAPHWVSFGIVPGYCVLAFILGTYWLTRQTARALRW AIEERTPSHDEARSAFLVPLRVALAVLFLWGAAAALWTIIYGLANRLFIPRFLFSMGVIG VVAATSCYLLTEFALRPMAAQALEVGATPRSLVRGIVGRTMLVWLLCSGVPNVGVALTAI FDDTFWELSNDQFMITVLILWAPLLIFGFILMWILAWLTATPVRVVREALNRVEQGDLSG DLVVFDGTELGELQRGFNRMVEGLRERERVRDLFGRHVGREVAAAAERERPKLGGEERHV AVVFVDIVGSTQLVTSRPAAEVVMLLNRFFTVIVDEVNHHRGLVNKFQGDASLAVFGAPN RLSHPEDAALATARAIADRLASEMPECQAGIGVAAGQVVAGNVGAHERFEYTVIGEPVNE AARLCELAKSYPSRLLASSQTLRGASENECARWSLGETVTLRGHDQPIRLTSPVQQLQMP AQSADIVGGALGDHQTHTIYRGAHPTD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Uncharacterized protein Rv1320c/MT1362(Rv1320c, MT1362) |
UniProt ID | Q10633 |
◆ Native Proteins | ||
Interferon alfa-P031H | Native Human interferon alpha therapeutic protein (Interferon alfa-n1) | +Inquiry |
CAT-75H | Native Human Catalase | +Inquiry |
KRT18-173B | Native bovine KRT18 | +Inquiry |
GPX1-8429H | Native Human GPX1 | +Inquiry |
Cp-674M | Native Mouse Ceruloplasmin | +Inquiry |
◆ Cell & Tissue Lysates | ||
SIK1-1842HCL | Recombinant Human SIK1 293 Cell Lysate | +Inquiry |
TCEANC2-8145HCL | Recombinant Human C1orf83 293 Cell Lysate | +Inquiry |
METTL20-8308HCL | Recombinant Human C12orf72 293 Cell Lysate | +Inquiry |
IL17RA-1252CCL | Recombinant Cynomolgus IL17RA cell lysate | +Inquiry |
BRD4-179HCL | Recombinant Human BRD4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Uncharacterized protein Rv1320c/MT1362(Rv1320c, MT1362) Products
Required fields are marked with *
My Review for All Uncharacterized protein Rv1320c/MT1362(Rv1320c, MT1362) Products
Required fields are marked with *
0
Inquiry Basket