Recombinant Full Length Uncharacterized Protein Rv0888/Mt0911 (Rv0888, Mt0911) Protein, His-Tagged
Cat.No. : | RFL30784HF |
Product Overview : | Recombinant Full Length Uncharacterized protein Rv0888/MT0911 (Rv0888, MT0911) Protein (P64743) (1-490aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-490) |
Form : | Lyophilized powder |
AA Sequence : | MDYAKRIGQVGALAVVLGVGAAVTTHAIGSAAPTDPSSSSTDSPVDACSPLGGSASSLAA IPGASVPQVGVRQVDPGSIPDDLLNALIDFLAAVRNGLVPIIENRTPVANPQQVSVPEGG TVGPVRFDACDPDGNRMTFAVRERGAPGGPQHGIVTVDQRTASFIYTADPGFVGTDTFSV NVSDDTSLHVHGLAGYLGPFHGHDDVATVTVFVGNTPTDTISGDFSMLTYNIAGLPFPLS SAILPRFFYTKEIGKRLNAYYVANVQEDFAYHQFLIKKSKMPSQTPPEPPTLLWPIGVPF SDGLNTLSEFKVQRLDRQTWYECTSDNCLTLKGFTYSQMRLPGGDTVDVYNLHTNTGGGP TTNANLAQVANYIQQNSAGRAVIVTGDFNARYSDDQSALLQFAQVNGLTDAWVQVEHGPT TPPFAPTCMVGNECELLDKIFYRSGQGVTLQAVSYGNEAPKFFNSKGEPLSDHSPAVVGF HYVADNVAVR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Uncharacterized protein Rv0888/MT0911 (Rv0888, MT0911) |
UniProt ID | P64743 |
◆ Recombinant Proteins | ||
YIPF5-6286R | Recombinant Rat YIPF5 Protein, His (Fc)-Avi-tagged | +Inquiry |
RAP2B-3604R | Recombinant Rhesus Macaque RAP2B Protein, His (Fc)-Avi-tagged | +Inquiry |
Tnfsf9-2099M | Recombinant Mouse Tnfsf9, FLAG-tagged | +Inquiry |
H2ax-1128M | Recombinant Mouse H2ax Protein, MYC/DDK-tagged | +Inquiry |
UBE2N-6403R | Recombinant Rat UBE2N Protein | +Inquiry |
◆ Native Proteins | ||
THBD-306R | Active Native Rabbit Lung Thrombomodulin | +Inquiry |
Hemocyanin-31S | Native Shrimp hemocyanin Protein, a substitute for KLH, animal free, SMCC Activated | +Inquiry |
vip3A-38B | Native Bacillus thuringiensis vip3A Protein | +Inquiry |
IgA-246H | Native Hamster Immunoglobulin A | +Inquiry |
ALB-315B | Native Bovine ALB protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYL10-1158HCL | Recombinant Human MYL10 cell lysate | +Inquiry |
PATZ1-3422HCL | Recombinant Human PATZ1 293 Cell Lysate | +Inquiry |
COL4A3BP-001HCL | Recombinant Human COL4A3BP cell lysate | +Inquiry |
ELMO2-6621HCL | Recombinant Human ELMO2 293 Cell Lysate | +Inquiry |
TUFM-1864HCL | Recombinant Human TUFM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Uncharacterized protein Rv0888/MT0911 (Rv0888, MT0911) Products
Required fields are marked with *
My Review for All Uncharacterized protein Rv0888/MT0911 (Rv0888, MT0911) Products
Required fields are marked with *
0
Inquiry Basket