Recombinant Full Length Uncharacterized Protein Rv0885/Mt0908 (Rv0885, Mt0908) Protein, His-Tagged
Cat.No. : | RFL27243HF |
Product Overview : | Recombinant Full Length Uncharacterized protein Rv0885/MT0908 (Rv0885, MT0908) Protein (P0A5D5) (1-340aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-340) |
Form : | Lyophilized powder |
AA Sequence : | MDRTRIVRRWRRNMDVADDAEYVEMLATLSEGSVRRNFNPYTDIDWESPEFAVTDNDPRW ILPATDPLGRHPWYQAQSRERQIEIGMWRQANVAKVGLHFESILIRGLMNYTFWMPNGSP EYRYCLHESVEECNHTMMFQEMVNRVGADVPGLPRRLRWVSPLVPLVAGPLPVAFFIGVL AGEEPIDHTQKNVLREGKSLHPIMERVMSIHVAEEARHISFAHEYLRKRLPRLTRMQRFW ISLYFPLTMRSLCNAIVVPPKAFWEEFDIPREVKKELFFGSPESRKWLCDMFADARMLAH DTGLMNPIARLVWRLCKIDGKPSRYRSEPQRQHLAAAPAA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Uncharacterized protein Rv0885/MT0908 (Rv0885, MT0908) |
UniProt ID | P0A5D5 |
◆ Recombinant Proteins | ||
SKINT5-8197M | Recombinant Mouse SKINT5 Protein, His (Fc)-Avi-tagged | +Inquiry |
PEX3-1651H | Recombinant Human PEX3, GST-tagged | +Inquiry |
GANR-2853B | Recombinant Bacillus subtilis GANR protein, His-tagged | +Inquiry |
CYP4F18-1750R | Recombinant Rat CYP4F18 Protein | +Inquiry |
NFATC2-181H | Recombinant Human NFATC2 protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
CKMM-382H | Native Human Creatine Kinase MM (CK-MM) | +Inquiry |
FABP3-09M | Native Mouse FABP3 protein | +Inquiry |
CHOD-22 | Active Native Cholesterol esterase | +Inquiry |
PLAU -15H | Native Human HMW urokinase, HRP conjugate | +Inquiry |
Egf-635R | Native Rat Egf | +Inquiry |
◆ Cell & Tissue Lysates | ||
DLGAP4-484HCL | Recombinant Human DLGAP4 cell lysate | +Inquiry |
MVD-4051HCL | Recombinant Human MVD 293 Cell Lysate | +Inquiry |
LRRC34-4634HCL | Recombinant Human LRRC34 293 Cell Lysate | +Inquiry |
PHF23-3228HCL | Recombinant Human PHF23 293 Cell Lysate | +Inquiry |
Eye-643B | Bovine Eye Retina Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Uncharacterized protein Rv0885/MT0908 (Rv0885, MT0908) Products
Required fields are marked with *
My Review for All Uncharacterized protein Rv0885/MT0908 (Rv0885, MT0908) Products
Required fields are marked with *
0
Inquiry Basket