Recombinant Full Length Uncharacterized Protein Rv0874C/Mt0897 (Rv0874C, Mt0897) Protein, His-Tagged
Cat.No. : | RFL24795HF |
Product Overview : | Recombinant Full Length Uncharacterized protein Rv0874c/MT0897 (Rv0874c, MT0897) Protein (P0A5D3) (1-386aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-386) |
Form : | Lyophilized powder |
AA Sequence : | MRIGVGVCTTPDARQAAVEAAGQARDELAGEAPSLAVLLGSRAHTDRAADVLSAVLQMID PPALVGCIAQAIVAGRHEIEDEPAVVVWLASGLAAETFQLDFVRTGSGALITGYRFDRTA RDLHLLLPDPYTFPSNLLIEHPNTDLPGTAVVGGVVSGGRRRGDTRLFRDHDVLTSGVVG VRLPGMRGVPVVSQGCRPIGYPYIVTGADGILITELGGRPPLQRLREIVEGLSPDERALV SHGLQIGIVVDEHLAAPGQGDFVIRGLLGADPSTGSIEIDEVVQVGATMQFQVRDAAGAD KDLRLTVERAAARLPGRAAGALLFTCNGRGRRMFGVADHDASTIEELLGGIPLAGFFAAG EIGPIAGRNALHGFTASMALFVDDME |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Uncharacterized protein Rv0874c/MT0897 (Rv0874c, MT0897) |
UniProt ID | P0A5D3 |
◆ Native Proteins | ||
Factor XIIIa-68H | Native Human Factor XIIIa protein | +Inquiry |
Cp-048R | Native Rat Ceruloplasmin | +Inquiry |
Staphylococcus aureus-01 | Native S. aureus Suspension (Wood 46 strain) | +Inquiry |
Lectin-1830R | Active Native Ricinus Communis Agglutinin I Protein, Agarose bound | +Inquiry |
Avidin-015 | Native Avidin Protein, Peroxidase conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF643-2067HCL | Recombinant Human ZNF643 cell lysate | +Inquiry |
RHOA-601HCL | Recombinant Human RHOA cell lysate | +Inquiry |
DDX31-7009HCL | Recombinant Human DDX31 293 Cell Lysate | +Inquiry |
NGFR-1670HCL | Recombinant Human NGFR cell lysate | +Inquiry |
S100A7-2088HCL | Recombinant Human S100A7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Uncharacterized protein Rv0874c/MT0897 (Rv0874c, MT0897) Products
Required fields are marked with *
My Review for All Uncharacterized protein Rv0874c/MT0897 (Rv0874c, MT0897) Products
Required fields are marked with *
0
Inquiry Basket