Recombinant Full Length Uncharacterized Protein Rv0479C/Mt0497 (Rv0479C, Mt0497) Protein, His-Tagged
Cat.No. : | RFL11756HF |
Product Overview : | Recombinant Full Length Uncharacterized protein Rv0479c/MT0497 (Rv0479c, MT0497) Protein (P64699) (1-348aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-348) |
Form : | Lyophilized powder |
AA Sequence : | MTNPQGPPNDPSPWARPGDQGPLARPPASSEASTGRLRPGEPAGHIQEPVSPPTQPEQQP QTEHLAASHAHTRRSGRQAAHQAWDPTGLLAAQEEEPAAVKTKRRARRDPLTVFLVLIIV FSLVLAGLIGGELYARHVANSKVAQAVACVVKDQATASFGVAPLLLWQVATRHFTNISVE TAGNQIRDAKGMQIKLTIQNVRLKNTPNSRGTIGALDATITWSSEGIKESVQNAIPILGA FVTSSVVTHPADGTVELKGLLNNITAKPIVAGKGLELQIINFNTLGFSLPKETVQSTLNE FTSSLTKNYPLGIHADSVQVTSTGVVSRFSTRDAAIPTGIQNPCFSHI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Uncharacterized protein Rv0479c/MT0497 (Rv0479c, MT0497) |
UniProt ID | P64699 |
◆ Recombinant Proteins | ||
ARF5-751R | Recombinant Rat ARF5 Protein | +Inquiry |
RFL23911YF | Recombinant Full Length Yersinia Pestis Bv. Antiqua Upf0283 Membrane Protein Ypn_1807(Ypn_1807) Protein, His-Tagged | +Inquiry |
FGFR4-57C | Recombinant Cynomolgus FGFR4, Fc tagged | +Inquiry |
Fbln7-227M | Recombinant Mouse Fbln7 Protein, His-tagged | +Inquiry |
RFL12564RF | Recombinant Full Length Rat Plasmolipin(Pllp) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Complement C1r-45H | Native Human Complement C1r | +Inquiry |
IgG-335G | Native GOAT Gamma Globulin Fraction | +Inquiry |
VTN-385P | Native Pig Vitronectin | +Inquiry |
Lectin-1756C | Active Native Canavalia ensiformis Concanavalin A Protein, Agarose bound | +Inquiry |
IgM-255H | Native Human Rheumatoid Factor IgM | +Inquiry |
◆ Cell & Tissue Lysates | ||
PIN1-3179HCL | Recombinant Human PIN1 293 Cell Lysate | +Inquiry |
ICA1L-5314HCL | Recombinant Human ICA1L 293 Cell Lysate | +Inquiry |
UQCRB-489HCL | Recombinant Human UQCRB 293 Cell Lysate | +Inquiry |
MRPS21-4145HCL | Recombinant Human MRPS21 293 Cell Lysate | +Inquiry |
TMED9-1021HCL | Recombinant Human TMED9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Uncharacterized protein Rv0479c/MT0497 (Rv0479c, MT0497) Products
Required fields are marked with *
My Review for All Uncharacterized protein Rv0479c/MT0497 (Rv0479c, MT0497) Products
Required fields are marked with *
0
Inquiry Basket