Recombinant Full Length Uncharacterized Protein Mb2609C (Mb2609C) Protein, His-Tagged
Cat.No. : | RFL8787MF |
Product Overview : | Recombinant Full Length Uncharacterized protein Mb2609c (Mb2609c) Protein (P65024) (1-340aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycobacterium Bovis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-340) |
Form : | Lyophilized powder |
AA Sequence : | MRWARQAVAVNGMPVDDGALPGLQRIGLVRSVRAPQFDGITFHEVLCKSALNKVPNAAAL PFRYTVNGYRGCSHACRYCFARPTHEYLDFNPGTDFDTQVVVKTNVAAVLRHELRRPSWR RETVALGTNTDPYQRAEGRYALMPGIIGALAASGTPLSILTKGTLLRRDLPLIAEAAQQV PVSVAVSLAVGDPELHRDVESGTPTPQARLALITAIRAAGLDCHVMVAPVLPQLTDSGEH LDQLLGQIAAAGATGVTVFGLHLRGSTRGWFMCWLARAHPELVSRYRELYRRGPYLPPSY REMLRERVAPLIAKYRLAGDHRPAPPETEAALVPVQATLF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BQ2027_MB2609C |
Synonyms | BQ2027_MB2609C; Uncharacterized protein Mb2609c |
UniProt ID | P65024 |
◆ Recombinant Proteins | ||
LRRC37B-4670H | Recombinant Human LRRC37B Protein | +Inquiry |
TSSK1B-29568TH | Recombinant Human TSSK1B | +Inquiry |
ETF1-28695TH | Recombinant Human ETF1 | +Inquiry |
PARP6-1534H | Recombinant Human PARP6, GST-tagged | +Inquiry |
SAP2-4542C | Recombinant Candida albicans (strain WO-1) SAP2 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CRYGD-01B | Native Bovine CRYGD protein | +Inquiry |
Lectin-1726W | Native Wheat Germ Lectin, FITC conjugated | +Inquiry |
NEFH-180B | Native bovine NEFH | +Inquiry |
MMP9-9810 | Active Native Human MMP9 | +Inquiry |
COL2A1-1647H | Native Human COL2A1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
POLR3H-3022HCL | Recombinant Human POLR3H 293 Cell Lysate | +Inquiry |
SLC35F5-1631HCL | Recombinant Human SLC35F5 cell lysate | +Inquiry |
IL21R-1442RCL | Recombinant Rat IL21R cell lysate | +Inquiry |
MT1H-4100HCL | Recombinant Human MT1H 293 Cell Lysate | +Inquiry |
CDS1-7605HCL | Recombinant Human CDS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All BQ2027_MB2609C Products
Required fields are marked with *
My Review for All BQ2027_MB2609C Products
Required fields are marked with *
0
Inquiry Basket