Recombinant Full Length Uncharacterized Protein Mb2601C (Mb2601C) Protein, His-Tagged
Cat.No. : | RFL9321MF |
Product Overview : | Recombinant Full Length Uncharacterized protein Mb2601c (Mb2601c) Protein (P65016) (1-355aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycobacterium Bovis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-355) |
Form : | Lyophilized powder |
AA Sequence : | MSASLLVRTACGGRAVAQRLRTVLWPITQTSVVAGLAWYLTHDVFNHPQAFFAPISAVVC MSATNVLRARRAQQMIVGVALGIVLGAGVHALLGSGPIAMGVVVFIALSVAVLCARGLVA QGLMFINQAAVSAVLVLVFASNGSVVFERLFDALVGGGLAIVFSILLFPPDPVVMLCSAR ADVLAAVRDILAELVNTVSDPTSAPPDWPMAAADRLHQQLNGLIEVRANAAMVARRAPRR WGVRSTVRDLDQQAVYLALLVSSVLHLARTIAGPGGDKLPTPVHAVLTDLAAGTGLADAD PTAANEHAAAARATASTLQSAACGSNEVVRADIVQACVTDLQRVIERPGPSGMSA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BQ2027_MB2601C |
Synonyms | BQ2027_MB2601C; Uncharacterized protein Mb2601c |
UniProt ID | P65016 |
◆ Native Proteins | ||
ALB-311H | Native Human Albumin, Texas Red Label | +Inquiry |
Ferritin-180M | Native Mouse Ferritin | +Inquiry |
Fga-63R | Native Rat Fibrinogen, FITC Labeled | +Inquiry |
CP-8075R | Native Rat Serum Ceruloplasmin | +Inquiry |
Collagen-325H | Native Human Collagen Type I | +Inquiry |
◆ Cell & Tissue Lysates | ||
KPNA6-4887HCL | Recombinant Human KPNA6 293 Cell Lysate | +Inquiry |
RBP4-2863HCL | Recombinant Human RBP4 cell lysate | +Inquiry |
BEND7-63HCL | Recombinant Human BEND7 lysate | +Inquiry |
ALAD-54HCL | Recombinant Human ALAD cell lysate | +Inquiry |
PHYH-3213HCL | Recombinant Human PHYH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BQ2027_MB2601C Products
Required fields are marked with *
My Review for All BQ2027_MB2601C Products
Required fields are marked with *
0
Inquiry Basket