Recombinant Full Length Uncharacterized Protein Mb2590 (Mb2590) Protein, His-Tagged
Cat.No. : | RFL33371MF |
Product Overview : | Recombinant Full Length Uncharacterized protein Mb2590 (Mb2590) Protein (P59983) (1-325aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycobacterium Bovis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-325) |
Form : | Lyophilized powder |
AA Sequence : | MSQPPEHPGNPADPQGGNQGAGSYPPPGYGAPPPPPGYGPPPGTYLPPGYNAPPPPPGYG PPPGPPPPGYPTHLQSSGFSVGDAISWSWNRFTQNAVTLVVPVLAYAVALAAVIGATAGL VVALSDRATTAYTNTSGVSSESVDITMTPAAGIVMFLGYIALFALVLYMHAGILTGCLDI ADGKPVTIATFFRPRNLGLVLVTGLLIVALTFIGGLLCVIPGLIFGFVAQFAVAFAVDRS TSPIDSVKASIETVGSNIGGSVLSWLAQLTAVLVGELLCFVGMLIGIPVAALIHVYTYRK LSGGQVVEAVRPAPPVGWPPGPQLA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BQ2027_MB2590 |
Synonyms | BQ2027_MB2590; Uncharacterized protein Mb2590 |
UniProt ID | P59983 |
◆ Recombinant Proteins | ||
IL16-14152H | Recombinant Human IL16, His-tagged | +Inquiry |
ACVR2B-8811Z | Recombinant Zebrafish ACVR2B | +Inquiry |
MPXV-0592 | Recombinant Monkeypox Virus J1L Protein, CC-type chemokine binding Protein | +Inquiry |
YDIR-1779B | Recombinant Bacillus subtilis YDIR protein, His-tagged | +Inquiry |
GPR64-2881H | Recombinant Human GPR64 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
ALB-37G | Native Goat Albumin (ALB) Protein | +Inquiry |
CRP-158R | Native Rabbit C-Reactive Protein | +Inquiry |
H3N2-01I | Active Native IAV H3N2 Protein | +Inquiry |
Prethrombin-2-304R | Native Rat Prethrombin-2 | +Inquiry |
Fixa-279B | Active Native Bovine Factor IXa - EGR | +Inquiry |
◆ Cell & Tissue Lysates | ||
NR4A3-3706HCL | Recombinant Human NR4A3 293 Cell Lysate | +Inquiry |
TCHP-660HCL | Recombinant Human TCHP lysate | +Inquiry |
P2RX1-464HCL | Recombinant Human P2RX1 lysate | +Inquiry |
Pancreas-648B | Bovine Pancreas Lysate, Total Protein | +Inquiry |
FBXO34-604HCL | Recombinant Human FBXO34 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BQ2027_MB2590 Products
Required fields are marked with *
My Review for All BQ2027_MB2590 Products
Required fields are marked with *
0
Inquiry Basket