Recombinant Full Length Uncharacterized Protein Mb2226 (Mb2226) Protein, His-Tagged
Cat.No. : | RFL7289MF |
Product Overview : | Recombinant Full Length Uncharacterized protein Mb2226 (Mb2226) Protein (P64950) (1-230aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycobacterium Bovis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-230) |
Form : | Lyophilized powder |
AA Sequence : | MPGPHSPNPGVGTNGPAPYPEPSSHEPQALDYPHDLGAAEPAFAPGPADDAALPPAAYPG VPPQVSYPKRRHKRLLIGIVVALALVSAMTAAIIYGVRTNGANTAGTFSEGPAKTAIQGY LNALENRDVDTIVRNALCGIHDGVRDKRSDQALAKLSSDAFRKQFSQVEVTSIDKIVYWS QYQAQVLFTMQVTPAAGGPPRGQVQGIAQLLFQRGQVLVCSYVLRTAGSY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BQ2027_MB2226 |
Synonyms | BQ2027_MB2226; Uncharacterized protein Mb2226 |
UniProt ID | P64950 |
◆ Recombinant Proteins | ||
RFL14726HF | Recombinant Full Length Human Cadherin-11(Cdh11) Protein, His-Tagged | +Inquiry |
TOB1-1110C | Recombinant Chicken TOB1 | +Inquiry |
MYL1-6758HF | Recombinant Full Length Human MYL1 Protein, GST-tagged | +Inquiry |
CAPN14-26H | Recombinant Human CAPN14 Protein, GST-tagged | +Inquiry |
YBX3-2150HF | Recombinant Full Length Human YBX3 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
C6-55H | Native Human Complement C6 | +Inquiry |
Collagen-319H | Native Human Collagen Type II | +Inquiry |
ATF-181R | Native Rat Apotransferrin | +Inquiry |
RO60-18C | Native Cattle RO60 Protein | +Inquiry |
Lectin-1796L | Active Native Lotus Tetragonolobus Lectin Protein, Agarose bound | +Inquiry |
◆ Cell & Tissue Lysates | ||
VGLL4-411HCL | Recombinant Human VGLL4 293 Cell Lysate | +Inquiry |
CD79A-7673HCL | Recombinant Human CD79A 293 Cell Lysate | +Inquiry |
TERF1-528HCL | Recombinant Human TERF1 cell lysate | +Inquiry |
TMEM187-681HCL | Recombinant Human TMEM187 lysate | +Inquiry |
TNFSF11-998HCL | Recombinant Human TNFSF11 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BQ2027_MB2226 Products
Required fields are marked with *
My Review for All BQ2027_MB2226 Products
Required fields are marked with *
0
Inquiry Basket