Recombinant Full Length Uncharacterized Protein Mb1311C (Mb1311C) Protein, His-Tagged
Cat.No. : | RFL36313MF |
Product Overview : | Recombinant Full Length Uncharacterized protein Mb1311c (Mb1311c) Protein (P66772) (1-591aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycobacterium Bovis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-591) |
Form : | Lyophilized powder |
AA Sequence : | MADRGQRRGCAPGIASALRASFQGKSRPWTQTRYWAFALLTPLVVAMVLTGCSASGTQLE LAPTADRRAAVGTTSDINQQDPATLQDGGNLRLSLTDFPPNFNILHIDGNNAEVAAMMKA TLPRAFIIGPDGSTTVDTNYFTSIELTRTAPQVVTYTINPEAVWSDGTPITWRDIASQIH AISGADKAFEIASSSGAERVASVTRGVDDRQAVVTFAKPYAEWRGMFAGNGMLLPASMTA TPEAFNKGQLDGPGPSAGPFVVSALDRTAQRIVLTRNPRWWGARPRLDSITYLVLDDAAR LPALQNNTIDATGVGTLDQLTIAARTKGISIRRAPGPSWYHFTLNGAPGSILADKALRLA IAKGIDRYTIARVAQYGLTSDPVPLNNHVFVAGQDGYQDNSGVVAYNPEQAKRELDALGW RRSGAFREKDGRQLVIRDLFYDAQSTRQFAQIAQHTLAQIGVKLELQAKSGSGFFSDYVN VGAFDIAQFGWVGDAFPLSSLTQIYASDGESNFGKIGSPQIDAAIERTLAELDPGKARAL ANQVDELIWAEGFSLPLTQSPGTVAVRSTLANFGATGLADLDYTAIGFMRR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BQ2027_MB1311C |
Synonyms | BQ2027_MB1311C; Uncharacterized protein Mb1311c |
UniProt ID | P66772 |
◆ Recombinant Proteins | ||
OCIAD1-10632Z | Recombinant Zebrafish OCIAD1 | +Inquiry |
GDI1-2504R | Recombinant Rat GDI1 Protein | +Inquiry |
ACVR2B-084H | Recombinant Human ACVR2B Protein, His-tagged | +Inquiry |
WFIKKN2-10173M | Recombinant Mouse WFIKKN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Il9-78M | Recombinant Mouse Il9 protein | +Inquiry |
◆ Native Proteins | ||
M. pneumoniae-28 | Native Mycoplasma pneumoniae Antigen | +Inquiry |
PLG-15H | Native Human Plasminogen Protein | +Inquiry |
Apotransferrin-37D | Native dog Apotransferrin | +Inquiry |
Egf-635R | Native Rat Egf | +Inquiry |
Pancreas-002H | Human Pancreas Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RASGRP3-2504HCL | Recombinant Human RASGRP3 293 Cell Lysate | +Inquiry |
SIAE-001HCL | Recombinant Human SIAE cell lysate | +Inquiry |
ERLIN1-6551HCL | Recombinant Human ERLIN1 293 Cell Lysate | +Inquiry |
U-251-017HCL | Human U-251 Whole Cell Lysate | +Inquiry |
BMF-8438HCL | Recombinant Human BMF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BQ2027_MB1311C Products
Required fields are marked with *
My Review for All BQ2027_MB1311C Products
Required fields are marked with *
0
Inquiry Basket