Recombinant Full Length Uncharacterized Protein Mb0508 (Mb0508) Protein, His-Tagged
Cat.No. : | RFL5535MF |
Product Overview : | Recombinant Full Length Uncharacterized protein Mb0508 (Mb0508) Protein (P64716) (1-310aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycobacterium Bovis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-310) |
Form : | Lyophilized powder |
AA Sequence : | MTGPHPETESSGNRQISVAELLARQGVTGAPARRRRRRRGDSDAITVAELTGEIPIIRDD HHHAGPDAHASQSPAANGRVQVGEAAPQSPAEPVAEQVAEEPTRTVYWSQPEPRWPKSPP QDRRESGPELSEYPRPLRHTHSDRAPAGPPSGAEHMSPDPVEHYPDLWVDVLDTEVGEAE AETEVREAQPGRGERHAAAAAAGTDVEGDGAAEARVARRALDVVPTLWRGALVVLQSILA VAFGAGLFIAFDQLWRWNSIVALVLSVMVILGLVVSVRAVRKTEDIASTLIAVAVGALIT LGPLALLQSG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BQ2027_MB0508 |
Synonyms | BQ2027_MB0508; Uncharacterized protein Mb0508 |
UniProt ID | P64716 |
◆ Native Proteins | ||
GUSB-12H | Active Native Helix pomatia b-Glucuronidase | +Inquiry |
MPOA-233H | Native Human Myeloperoxidase Isoform A | +Inquiry |
C4B-99H | Native Human C4b Binding Protein | +Inquiry |
CKMB-165H | Active Native Human Creatine Kinase MB | +Inquiry |
Hp2-2-196H | Native Human Haptoglobin 2-2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TP53-860HCL | Recombinant Human TP53 293 Cell Lysate | +Inquiry |
MBL2-001HCL | Recombinant Human MBL2 cell lysate | +Inquiry |
NET1-3873HCL | Recombinant Human NET1 293 Cell Lysate | +Inquiry |
NPY1R-1214HCL | Recombinant Human NPY1R cell lysate | +Inquiry |
GFOD2-697HCL | Recombinant Human GFOD2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BQ2027_MB0508 Products
Required fields are marked with *
My Review for All BQ2027_MB0508 Products
Required fields are marked with *
0
Inquiry Basket