Recombinant Full Length Uncharacterized Protein C03F11.3(C03F11.3) Protein, His-Tagged
Cat.No. : | RFL24859CF |
Product Overview : | Recombinant Full Length Uncharacterized protein C03F11.3(C03F11.3) Protein (Q11124) (1-563aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-563) |
Form : | Lyophilized powder |
AA Sequence : | MASRSCICQVSAGIIFLIGAALLVAGLVIVLNVFPNIVNNQINDSKVLGLNADGTLNSFT DSWVNSKYISTMQYWVYDYTNTIGIMNRAIYPDVREKGPYAFDEILTMDKLNFSENGEFM EFRQIQTFVFNPNKSCAGCDPYKDKVLIPDMGFQVGIDQIDTVIEGILKNPLAATICHAI MKGKPNANQTCSNLGALIEGELGTLISLFNVSPFTTVTVDQLLFSGYKTPFVEKFLDEAL GMLHFLFGTAPKPLDDPPIQLNPLNGTSDIINTVLTGKTDPLKAGYMTEFRSISNNSLFN SIGNTLPPMWWPYANKTYCKDPNSALVLTGTNGDYFKNFVKKTDILPAFVSDVCRTIHFV FDREVTVKGFKGYRFVMPPTQFDYSLDENCGYCIPLKYGSYEYPAQSACLPSGLLDISQC TGGPIIMSKPHFYQASKVVSKFVPRFKPTYDNDETMLDIEPNTGTVLQAQKRLQINMLVN QFKHIRSYSVMRPGAYPLAWVNESFYMDQNTIDQLNSQLFTPVSTVNTICWIAVGLGAGL IALSIVMVIVSFCCFRDEHHKTS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | C03F11.3 |
Synonyms | C03F11.3; Uncharacterized protein C03F11.3 |
UniProt ID | Q11124 |
◆ Recombinant Proteins | ||
CYP2E1-221H | Active Recombinant Human CYP2E1 Protein | +Inquiry |
YOSV-3111B | Recombinant Bacillus subtilis YOSV protein, His-tagged | +Inquiry |
HBG1-1048H | Recombinant Human HBG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SH-RS06110-5452S | Recombinant Staphylococcus haemolyticus JCSC1435 SH_RS06110 protein, His-tagged | +Inquiry |
IL10RA-051H | Active Recombinant Human IL10RA protein, Fc/Avi-tagged, Biotinylated | +Inquiry |
◆ Native Proteins | ||
BCHE-157H | Active Native Horse Serum Butyrylcholinesterase | +Inquiry |
FLNA-170C | Active Native chicken FLNA | +Inquiry |
TG-31519TH | Native Human TG | +Inquiry |
Tryptase-61H | Native Human Mast Cell Tryptase | +Inquiry |
Y. enterocolitica-30 | Native Yersinia enterocolitica O:8 Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF5-6642HCL | Recombinant Human EIF5 293 Cell Lysate | +Inquiry |
HSD3B1-5370HCL | Recombinant Human HSD3B1 293 Cell Lysate | +Inquiry |
SPRY1-1491HCL | Recombinant Human SPRY1 293 Cell Lysate | +Inquiry |
ELF5-6630HCL | Recombinant Human ELF5 293 Cell Lysate | +Inquiry |
DMAP1-6902HCL | Recombinant Human DMAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All C03F11.3 Products
Required fields are marked with *
My Review for All C03F11.3 Products
Required fields are marked with *
0
Inquiry Basket