Recombinant Full Length Uncharacterized Ppe Family Protein Ppe45(Ppe45) Protein, His-Tagged
Cat.No. : | RFL24956MF |
Product Overview : | Recombinant Full Length Uncharacterized PPE family protein PPE45(ppe45) Protein (P0A695) (1-408aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycobacterium Bovis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-408) |
Form : | Lyophilized powder |
AA Sequence : | MDFGVLPPEINSGRMYAGPGSGPMMAAAAAWDSLAAELGLAAGGYRLAISELTGAYWAGP AAASMVAAVTPYVAWLSATAGQAEQAGMQARAAAAAYELAFAMTVPPPVVVANRALLVAL VATNFFGQNTPAIAATEAQYAEMWAQDAAAMYAYAGSAAIATELTPFTAAPVTTSPAALA GQAAATVSSTVPPLATTAAVPQLLQQLSSTSLIPWYSALQQWLAENLLGLTPDNRMTIVR LLGISYFDEGLLQFEASLAQQAIPGTPGGAGDSGSSVLDSWGPTIFAGPRASPSVAGGGA VGGVQTPQPYWYWALDRESIGGSVSAALGKGSSAGSLSVPPDWAARARWANPAAWRLPGD DVTALRGTAENALLRGFPMASAGQSTGGGFVHKYGFRLAVMQRPPFAG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PPE45 |
Synonyms | PPE45; BQ2027_MB2916C; Uncharacterized PPE family protein PPE45 |
UniProt ID | P0A695 |
◆ Recombinant Proteins | ||
EPO-4238H | Recombinant Horse EPO protein, His-tagged | +Inquiry |
TMEM176A-4786R | Recombinant Rhesus monkey TMEM176A Protein, His-tagged | +Inquiry |
RABL5-7377M | Recombinant Mouse RABL5 Protein, His (Fc)-Avi-tagged | +Inquiry |
BEX1-199H | Recombinant Human BEX1 Protein, GST-tagged | +Inquiry |
PDGFA-2569H | Recombinant Human PDGFA Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Crp-5382R | Native Rat C-Reactive Protein, Petaxin Related | +Inquiry |
ighg1-160M | Native Mouse Immunoglobulin G1 | +Inquiry |
GG-186G | Native Goat Gamma Globulin protein | +Inquiry |
DENV2-01DCL | Native DENV2 Lysate | +Inquiry |
ORM1-8017R | Native Rat Serum Alpha-1-Acid GlycoProtein | +Inquiry |
◆ Cell & Tissue Lysates | ||
OR2L2-3561HCL | Recombinant Human OR2L2 293 Cell Lysate | +Inquiry |
IL36B-5236HCL | Recombinant Human IL1F8 293 Cell Lysate | +Inquiry |
ERBB4-895RCL | Recombinant Rat ERBB4 cell lysate | +Inquiry |
HA-2327HCL | Recombinant H5N1 HA cell lysate | +Inquiry |
ABCC3-9150HCL | Recombinant Human ABCC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPE45 Products
Required fields are marked with *
My Review for All PPE45 Products
Required fields are marked with *
0
Inquiry Basket