Recombinant Full Length Uncharacterized Membrane Protein Rv3835/Mt3943 (Rv3835, Mt3943) Protein, His-Tagged
Cat.No. : | RFL22787HF |
Product Overview : | Recombinant Full Length Uncharacterized membrane protein Rv3835/MT3943 (Rv3835, MT3943) Protein (P96243) (1-449aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-449) |
Form : | Lyophilized powder |
AA Sequence : | MLDAPEQDPVDPGDPASPPHGEAEQPLPGPRWPRALRASATRRALLLTALGGLLIAGLVT AIPAVGRAPERLAGYIASNPVPSTGAKINASFNRVASGDCLMWPDGTPESAAIVSCADEH RFEVAESIDMRTFPGMEYGQNAAPPSPARIQQISEEQCEAAVRRYLGTKFDPNSKFTISM LWPGDRAWRQAGERRMLCGLQSPGPNNQQLAFKGKVADIDQSKVWPAGTCLGIDATTNQP IDVPVDCAAPHAMEVSGTVNLAERFPDALPSEPEQDGFIKDACTRMTDAYLAPLKLRTTT LTLIYPTLTLPSWSAGSRVVACSIGATLGNGGWATLVNSAKGALLINGQPPVPPPDIPEE RLNLPPIPLQLPTPRPAPPAQQLPSTPPGTQHLPAQQPVVTPTRPPESHAPASAAPAETQ PPPPDAGAPPATQSPEATPPGPAEPAPAG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Uncharacterized membrane protein Rv3835/MT3943 (Rv3835, MT3943) |
UniProt ID | P96243 |
◆ Recombinant Proteins | ||
TBX3-5975R | Recombinant Rat TBX3 Protein | +Inquiry |
TGFB3-2462H | Recombinant Human TGFB3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SERPINH1-576H | Recombinant Full Length Human SERPINH1 Protein, His-tagged | +Inquiry |
Tnfrsf4-4200M | Active Recombinant Mouse Tnfrsf4 protein, His-tagged | +Inquiry |
VP40-403V | Recombinant Lake Victoria Matrix VP40 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Hb-197H | Native Human Hemoglobin | +Inquiry |
Lectin-1736C | Active Native Canavalia ensiformis Concanavalin A Protein, Rhodamine labeled | +Inquiry |
Acid phosphatase-158 | Active Native Wheat Germ Acid phosphatase Protein | +Inquiry |
LOX3-11S | Native Soybeans LOX3 Protein | +Inquiry |
IgG-151M | Native Mouse IgG Fab fragment | +Inquiry |
◆ Cell & Tissue Lysates | ||
EZH1-6488HCL | Recombinant Human EZH1 293 Cell Lysate | +Inquiry |
WDR12-355HCL | Recombinant Human WDR12 293 Cell Lysate | +Inquiry |
SNB75-009WCY | Human Brain Glioblastoma SNB75 Whole Cell Lysate | +Inquiry |
TAL2-1258HCL | Recombinant Human TAL2 293 Cell Lysate | +Inquiry |
NFATC3-3856HCL | Recombinant Human NFATC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Uncharacterized membrane protein Rv3835/MT3943 (Rv3835, MT3943) Products
Required fields are marked with *
My Review for All Uncharacterized membrane protein Rv3835/MT3943 (Rv3835, MT3943) Products
Required fields are marked with *
0
Inquiry Basket