Recombinant Full Length Uncharacterized Membrane Protein Otcpg00060(Otcpg00060) Protein, His-Tagged
Cat.No. : | RFL31957OF |
Product Overview : | Recombinant Full Length Uncharacterized membrane protein OtCpg00060(OtCpg00060) Protein (Q0P3P6) (1-537aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ostreococcus tauri |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-537) |
Form : | Lyophilized powder |
AA Sequence : | MENSIGLGLIHGLMYGIVPVAPWFVALKRYLLEGKEKGQLAVAGTIAGQVTLLALTFFGW SRVLWVWYYFEPALIILGTMAVVRCALDCWVEQESSLRTAALGPGAGQLASKQEGLYYFL MSFGLMFCNPLHLEGSQTLLSSIPGNRYVYLLAFTVSYTAIIFIFWVTLGYRIFGKAYSG FGAQQTLNRYRIRRVSVGIVAALFLQFANCTPEALVIYHWDSLLAYTPFDGLKHHRTRGY TWEPSSDNAFELSRQSYRATNRAGVSFEQGAKRAVQFKPFWNTETRFDECNQVRERELSN EDWNAEATFHEFQGINQGVLRARSVPFNLYMVPNWEKQEDKNYLLTLRQIRDEMDDKLMA ESSPQERFLVSPFTDNLDYEVDYQVYPELMAEKAQTKTAYADMVKLIRGTKWTSNHVHLG DGTDVEMSYAKLHALPAEVRLPWHYPVVKPTEVVVQTSSTDTPDSVQLLNDELQENLHFF SNEPERIQQNVYKRLWEHRTFGKVTPRMIDDKVQKRLDDRVNMRREAYVSSNPTKAK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OtCpg00060 |
Synonyms | OtCpg00060; Uncharacterized membrane protein OtCpg00060; ORF537 |
UniProt ID | Q0P3P6 |
◆ Native Proteins | ||
GS-32 | Active Native Glutamine synthetase | +Inquiry |
ADVag-271V | Active Native ADV(Type 6, strain Tonsil 99) Protein | +Inquiry |
Lectin-1727W | Native Wheat Germ Lectin, Biotin conjugated | +Inquiry |
Proteoglycans-54B | Native Bovine Proteoglycans | +Inquiry |
C4-195H | Native Human Complement C4c | +Inquiry |
◆ Cell & Tissue Lysates | ||
MED27-4385HCL | Recombinant Human MED27 293 Cell Lysate | +Inquiry |
NCF2-005HCL | Recombinant Human NCF2 cell lysate | +Inquiry |
MITD1-4307HCL | Recombinant Human MITD1 293 Cell Lysate | +Inquiry |
SRP72-1477HCL | Recombinant Human SRP72 293 Cell Lysate | +Inquiry |
KIF2C-4946HCL | Recombinant Human KIF2C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OtCpg00060 Products
Required fields are marked with *
My Review for All OtCpg00060 Products
Required fields are marked with *
0
Inquiry Basket