Recombinant Full Length Umbelopsis Ramanniana Diacylglycerol O-Acyltransferase 2B(Dgat2B) Protein, His-Tagged
Cat.No. : | RFL6128UF |
Product Overview : | Recombinant Full Length Umbelopsis ramanniana Diacylglycerol O-acyltransferase 2B(DGAT2B) Protein (Q96UY1) (1-349aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Umbelopsis ramanniana (Oleaginous fungus) (Mortierella ramanniana) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-349) |
Form : | Lyophilized powder |
AA Sequence : | MEQVQVTALLDHIPKVHWAPLRGIPLKRRLQTSAIVTWLALLPICLIIYLYLFTIPLLWP ILIMYTIWLFFDKAPENGGRRISLVRKLPLWKHFANYFPVTLIKEGDLDPKGNYIMSYHP HGIISMAAFANFATEATGFSEQYPGIVPSLLTLASNFRLPLYRDFMMSLGMCSVSRHSCE AILRSGPGRSIVIVTGGASESLSARPGTNDLTLKKRLGFIRLAIRNGASLVPIFSFGEND IYEQYDNKKGSLIWRYQKWFQKITGFTVPLAHARGIFNYNAGFIPFRHPIVTVVGKPIAV PLLAEGETEPSEEQMHQVQAQYIESLQAIYDKYKDIYAKDRIKDMTMIA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | DGAT2B |
Synonyms | DGAT2B; Diacylglycerol O-acyltransferase 2B; Diglyceride acyltransferase 2B; MrDGAT2B |
UniProt ID | Q96UY1 |
◆ Recombinant Proteins | ||
RFL10220LF | Recombinant Full Length Lactuca Sativa Photosystem Ii Reaction Center Protein Z(Psbz) Protein, His-Tagged | +Inquiry |
DGKB-1855R | Recombinant Rat DGKB Protein | +Inquiry |
Sp9-6064M | Recombinant Mouse Sp9 Protein, Myc/DDK-tagged | +Inquiry |
Ceacam1-3312MAF647 | Recombinant Mouse Ceacam1 Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
CCL18-164H | Recombinant Human CCL18, 22-89 aa, His-tagged | +Inquiry |
◆ Native Proteins | ||
HBsAg-01 | Native Hepatitis B Surface Ag protein | +Inquiry |
Staphylococcus aureus-01 | Native S. aureus Suspension (Wood 46 strain) | +Inquiry |
Tf-264R | Native Rat Transferrin | +Inquiry |
IgE-507H | Native Human IgE protein | +Inquiry |
Lectin-1819P | Active Native Phaseolus Vulgaris Erythroagglutinin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLRD1-4893HCL | Recombinant Human KLRD1 293 Cell Lysate | +Inquiry |
UBE2D3-586HCL | Recombinant Human UBE2D3 293 Cell Lysate | +Inquiry |
PLA1A-1366HCL | Recombinant Human PLA1A cell lysate | +Inquiry |
MCOLN1-4414HCL | Recombinant Human MCOLN1 293 Cell Lysate | +Inquiry |
LIF-1729MCL | Recombinant Mouse LIF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DGAT2B Products
Required fields are marked with *
My Review for All DGAT2B Products
Required fields are marked with *
0
Inquiry Basket