Recombinant Full Length Umbelopsis Ramanniana Diacylglycerol O-Acyltransferase 2A(Dgat2A) Protein, His-Tagged

• Cat.No.: RFL20510UF
• Product Overview: Recombinant Full Length Umbelopsis ramanniana Diacylglycerol O-acyltransferase 2A(DGAT2A) Protein (Q96UY2) (1-355aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Umbelopsis ramanniana (Oleaginous fungus) (Mortierella ramanniana)
• Source: E.coli
• Tag: His
• ProteinLength: Full Length (1-355)
• Form: Lyophilized powder
• AA Sequence: MASKDQHLQQKVKHTLEAIPSPRYAPLRVPLRRRLQTLAVLLWCSMMSICMFIFFFLCSI PVLLWFPIILYLTWILVWDKAPENGGRPIRWLRNAAWWKLFAGYFPAHVIKEADLDPSKN YIFGYHPHGIISMGSFCTFSTNATGFDDLFPGIRPSLLTLTSNFNIPLYRDYLMACGLCS VSKTSCQNILTKGGPGRSIAIVVGGASESLNARPGVMDLVLKRRFGFIKIAVQTGASLVP TISFGENELYEQIESNENSKLHRWQKKIQHALGFTMPLFHGRGVFNYDFGLLPHRHPIYT IVGKPIPVPSIKYGQTKDEIIRELHDSYMHAVQDLYDRYKDIYAKDRVKELEFVE
• Purity: Greater than 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: DGAT2A
• Synonyms: DGAT2A; Diacylglycerol O-acyltransferase 2A; Diglyceride acyltransferase 2A; MrDGAT2A
• UniProt ID: Q96UY2