Recombinant Full Length Trk System Potassium Uptake Protein Trkh(Trkh) Protein, His-Tagged
Cat.No. : | RFL7774SF |
Product Overview : | Recombinant Full Length Trk system potassium uptake protein trkH(trkH) Protein (P0AFZ9) (1-483aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Shigella flexneri |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-483) |
Form : | Lyophilized powder |
AA Sequence : | MHFRAITRIVGLLVILFSGTMIIPGLVALIYRDGAGRAFTQTFFVALAIGSMLWWPNRKE KGELKSREGFLIVVLFWTVLGSVGALPFIFSESPNLTITDAFFESFSGLTTTGATTLVGL DSLPHAILFYRQMLQWFGGMGIIVLAVAILPILGVGGMQLYRAEMPGPLKDNKMRPRIAE TAKTLWLIYVLLTVACALALWFAGMDAFDAIGHSFATIAIGGFSTHDASIGYFDSPTINT IIAIFLLISGCNYGLHFSLLSGRSLKVYWRDPEFRMFIGVQFTLVVICTLVLWFHNVYSS ALMTINQAFFQVVSMATTAGFTTDSIARWPLFLPVLLLCSAFIGGCAGSTGGGLKVIRIL LLFKQGNRELKRLVHPNAVYSIKLGNRALPERILEAVWGFFSAYALVFIVSMLAIIATGV DDFSAFASVVATLNNLGPGLGVVADNFTSMNPVAKWILIANMLFGRLEVFTLLVLFTPTF WRE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | trkH |
Synonyms | trkH; SF3925; S3827; Trk system potassium uptake protein TrkH |
UniProt ID | P0AFZ9 |
◆ Recombinant Proteins | ||
XYND-0999B | Recombinant Bacillus subtilis XYND protein, His-tagged | +Inquiry |
ID1-14041H | Recombinant Human ID1, GST-tagged | +Inquiry |
CCDC32-600H | Recombinant Human CCDC32 Protein, MYC/DDK-tagged | +Inquiry |
AKAP14-9520H | Recombinant Human AKAP14, GST-tagged | +Inquiry |
MCM6-28042TH | Recombinant Human MCM6 | +Inquiry |
◆ Native Proteins | ||
APOA1-8344H | Native Human APOA1 | +Inquiry |
FABP-175C | Native Guinea Pig Fatty acid Binding Protein | +Inquiry |
NFL-01P | Native Pig NFL Protein (549 AA) | +Inquiry |
IgA-302H | Native Human Immunoglobulin A | +Inquiry |
Thrombin-25H | Active Native Human β-thrombin | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCNK4-323HCL | Recombinant Human KCNK4 Lysate | +Inquiry |
QDPR-520HCL | Recombinant Human QDPR lysate | +Inquiry |
UQCR10-490HCL | Recombinant Human UQCR10 293 Cell Lysate | +Inquiry |
NKX2-3812HCL | Recombinant Human NKX2 293 Cell Lysate | +Inquiry |
UBXN2A-539HCL | Recombinant Human UBXN2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All trkH Products
Required fields are marked with *
My Review for All trkH Products
Required fields are marked with *
0
Inquiry Basket