Recombinant Full Length Triticum Timopheevii Atp Synthase Subunit A(Atp6) Protein, His-Tagged
Cat.No. : | RFL26132TF |
Product Overview : | Recombinant Full Length Triticum timopheevii ATP synthase subunit a(ATP6) Protein (P68526) (1-386aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Triticum timopheevii (Timopheev's wheat) (Triticum dicoccon var. timopheevii) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-386) |
Form : | Lyophilized powder |
AA Sequence : | MRFLSTDMKDRNMLFAAITTNQPIRSKCSRLPDLHDFFPTNISQNFAITPNLDITPTPER IAGVTIVLQIEEYLGQNESEQGAVNLARTVLGARHRNGETWQGILEDIRAGGGMDNFIQN LPGAYPETPLDQFAIIPIIDLHVGNFYLSFTNEVLYMLLTVVLVVFLFFVVTKKGGGKSV PNAWQSLVELIYDFVLNLVNEQIGGLSGNVKQKFFPRISVTFTFSLFRNPQGMIPFSFTV TSHFLITLALSFSIFIGITIVGFQRHGLHFFSFLLPAGVPLPLAPFLVLLELISYCFRAL SLGIRLFANMMAGHSLVKILSGFAWTMLFLNNIFYFIGDLGPLFIVLALTGLELGVAISQ AHVSTISICIYLNDATNLHQNESFHN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ATP6 |
Synonyms | ATP6; ATP synthase subunit a; F-ATPase protein 6 |
UniProt ID | P68526 |
◆ Native Proteins | ||
CA19-9-01H | Active Native Human CA19-9 protein | +Inquiry |
APOC3-361H | Native Human Apolipoprotein C-III | +Inquiry |
CTSH-360H | Native Human Eosinophil Peroxidase | +Inquiry |
Avidin-014 | Native Avidin Protein, Gold conjugated | +Inquiry |
GLDH-213B | Active Native Bovine Glutamate Dehydrogenase | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL6-5224HCL | Recombinant Human IL6 293 Cell Lysate | +Inquiry |
APLNR-8791HCL | Recombinant Human APLNR 293 Cell Lysate | +Inquiry |
CT45A3-1536HCL | Recombinant Human CT45A3 cell lysate | +Inquiry |
CPB1-3029HCL | Recombinant Human CPB1 cell lysate | +Inquiry |
CELF5-184HCL | Recombinant Human CELF5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATP6 Products
Required fields are marked with *
My Review for All ATP6 Products
Required fields are marked with *
0
Inquiry Basket