Recombinant Full Length Triticum Aestivum Casp-Like Protein Stg(Stg) Protein, His-Tagged
Cat.No. : | RFL7222TF |
Product Overview : | Recombinant Full Length Triticum aestivum CASP-like protein STG(STG) Protein (E6Y2A0) (1-226aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Triticum aestivum |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-226) |
Form : | Lyophilized powder |
AA Sequence : | MSTSEAATVIPVYDVAPGQGAPSKAPAAAPPSAAAAAPAAAATTTAPRKFPMRFFRRSDR GSRCMAFLDFLLRIAAFGPALAAAIATGTSDETLSVFTEFFQFRARFDEFPAFLFLMVAS AIAAGYLLLSLPFSAVVVLRPQTTVLRLLLLVCDTIMLGLLTAGAAAAAAIVDLAHSGNE RANWVPICMQFHGFCRRTSGAVVASFLSVFIFVLLVVLAAFSIRKR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | STG |
Synonyms | STG; Casparian strip membrane protein 1; TaCASP1; Salt tolerance protein; TaSTG |
UniProt ID | E6Y2A0 |
◆ Recombinant Proteins | ||
RFL7222TF | Recombinant Full Length Triticum Aestivum Casp-Like Protein Stg(Stg) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All STG Products
Required fields are marked with *
My Review for All STG Products
Required fields are marked with *
0
Inquiry Basket