Recombinant Full Length Triticum Aestivum Atp Synthase Subunit A(Atp6) Protein, His-Tagged
Cat.No. : | RFL2220TF |
Product Overview : | Recombinant Full Length Triticum aestivum ATP synthase subunit a(ATP6) Protein (P68527) (1-386aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Triticum aestivum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-386) |
Form : | Lyophilized powder |
AA Sequence : | MRFLSTDMKDRNMLFAAITTNQPIRSKCSRLPDLHDFFPTNISQNFAITPNLDITPTPER IAGVTIVLQIEEYLGQNESEQGAVNLARTVLGARHRNGETWQGILEDIRAGGGMDNFIQN LPGAYPETPLDQFAIIPIIDLHVGNFYLSFTNEVLYMLLTVVLVVFLFFVVTKKGGGKSV PNAWQSLVELIYDFVLNLVNEQIGGLSGNVKQKFFPRISVTFTFSLFRNPQGMIPFSFTV TSHFLITLALSFSIFIGITIVGFQRHGLHFFSFLLPAGVPLPLAPFLVLLELISYCFRAL SLGIRLFANMMAGHSLVKILSGFAWTMLFLNNIFYFIGDLGPLFIVLALTGLELGVAISQ AHVSTISICIYLNDATNLHQNESFHN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ATP6 |
Synonyms | ATP6; ATP synthase subunit a; F-ATPase protein 6 |
UniProt ID | P68527 |
◆ Recombinant Proteins | ||
ABHD6-6843H | Recombinant Human ABHD6 protein, His-tagged | +Inquiry |
PPP2R1B-27569TH | Recombinant Human PPP2R1B | +Inquiry |
YJCL-4053B | Recombinant Bacillus subtilis YJCL protein, His-tagged | +Inquiry |
NS2A-4264Y | Recombinant Yellow fever virus NS2A protein, His-GST & Myc-tagged | +Inquiry |
IFNAR2-157H | Active Recombinant Human IFNAR2 protein(Met1-Lys243), hFc-tagged | +Inquiry |
◆ Native Proteins | ||
VTN-2H | Native Human monomeric vitronectin, Biotin labeled | +Inquiry |
SHBG-30637TH | Native Human SHBG protein | +Inquiry |
LDL-247H | Native Human Lipoproteins, Very Low Density | +Inquiry |
gG2-650V | Native Herpes Simplex Virus gG2 Protein | +Inquiry |
APOA1-23D | Native Dog Apolipoprotein A1 (APOA1) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RIN1-1511HCL | Recombinant Human RIN1 cell lysate | +Inquiry |
Ovary-816H | Hamster Ovary Membrane Lysate, Total Protein | +Inquiry |
ALX1-8890HCL | Recombinant Human ALX1 293 Cell Lysate | +Inquiry |
ACHN-029WCY | Human Kidney Renal Cell Adenocarcinoma ACHN Whole Cell Lysate | +Inquiry |
OTULIN-252HCL | Recombinant Human OTULIN lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ATP6 Products
Required fields are marked with *
My Review for All ATP6 Products
Required fields are marked with *
0
Inquiry Basket