Recombinant Full Length Trichophyton Verrucosum Bifunctional Lycopene Cyclase/Phytoene Synthase (Trv_03236) Protein, His-Tagged
Cat.No. : | RFL2326TF |
Product Overview : | Recombinant Full Length Trichophyton verrucosum Bifunctional lycopene cyclase/phytoene synthase (TRV_03236) Protein (D4D802) (1-595aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Trichophyton verrucosum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-595) |
Form : | Lyophilized powder |
AA Sequence : | MGLDYLMVHVKYNIPPALLLTILYKPFFTRLEVYKIVFLCTIAVVWTTPWDSYLIRTRVW SYPADSVIGHTIFRIPLEEAFFFIIQTYNTSLIYILFNKRLILLPYLSGPIKPLTQGLFG TVALRTWRDFGILFFTGISVLGISCIRAGGEYMYLGLILSWISPILLLQWPLMYRFLLGL PPASLWVPIVLPTLYLWIVDTLALRRGTWVIESGTKVDIQLWDGLELEEALFFLVTNVMI VLGIAGMDNAIALFEYKAFVSTTAVGETPSIPRLLTLFFTRSRRYCDTNVLREMSQAVTL LKQKSQTMYLGSAMFEGQLRLDLVALYSFCRKADDLIDDAPNRATAQYWIKQCEKALELR FKLKGAALDNTAAYQQLTKSIPPQLHAAVHLLPASRLPKGPLSDLLKGFEIDMKFDSERG IFPIATEHDLEVYAYHVAGTIATLLLELVFRHHPVSISDSERLRVISAGEGMGRALQYTN IARDIVRDAEIGRVYIPSVWLAEQGLTPSMVVNQPRNPKLIPLRRRLLDKAEKCYRDTQE AISELPANVRAPVRATVTVYMDIGQVIRENEMKVWNGKLKVSRWRRFKGAWLAMS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TRV_03236 |
Synonyms | TRV_03236; Bifunctional lycopene cyclase/phytoene synthase [Includes: Lycopene beta-cyclase; Lycopene cyclase; Phytoene synthase; ] |
UniProt ID | D4D802 |
◆ Recombinant Proteins | ||
SERPINF2-5923H | Recombinant Full Length Human SERPINF2 Protein (Met1-Lys491), C-Strep tagged | +Inquiry |
MSH5-1240H | Recombinant Human MSH5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SEPT9A-9871Z | Recombinant Zebrafish SEPT9A | +Inquiry |
RAB7A-1118D | Active Recombinant Dog RAB7A, Member RAS Oncogene Family, GST-His | +Inquiry |
P21-00140-2258S | Recombinant Staphylococcus aureus P21_00140 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
YFP-101 | Yellow Fluorescent Protein | +Inquiry |
gp125-261V | Native EBV Viral Capsid gp125 Protein | +Inquiry |
GLDH-120B | Active Native Bovine Glutamate Dehydrogenase | +Inquiry |
Collagen type I-02H | Native Human Collagen type I Protein | +Inquiry |
F10-63H | Native Human Factor X | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASH2L-8652HCL | Recombinant Human ASH2L 293 Cell Lysate | +Inquiry |
MAGEB3-4544HCL | Recombinant Human MAGEB3 293 Cell Lysate | +Inquiry |
EPB41L2-561HCL | Recombinant Human EPB41L2 cell lysate | +Inquiry |
Fetal Kidney-144H | Human Fetal Kidney Cytoplasmic Lysate | +Inquiry |
ISCA1-5155HCL | Recombinant Human ISCA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TRV_03236 Products
Required fields are marked with *
My Review for All TRV_03236 Products
Required fields are marked with *
0
Inquiry Basket