Recombinant Full Length Trichodesmium Erythraeum Atp-Dependent Zinc Metalloprotease Ftsh(Ftsh) Protein, His-Tagged
Cat.No. : | RFL14176TF |
Product Overview : | Recombinant Full Length Trichodesmium erythraeum ATP-dependent zinc metalloprotease FtsH(ftsH) Protein (Q10ZF7) (1-667aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Trichodesmium erythraeum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-667) |
Form : | Lyophilized powder |
AA Sequence : | MKNFGQQIKTDELKGINHHNWSLCQAQSNTQKAKILFGRIPGGKLTRKLGWKILATGIIA QAVLLVSPAFANSTQKNLSYSQLLDKIQAGEVTEIDYYPSRGIAKVSLKGQRSREGMYIV QMFEHVPELLDQVRAQKIDFELKRSPDNSVAMGIIFNILIVFVVIVVLLAILRRSSQSQG NALNFGKSRARFQMEAKTGVLFEDVAGIEEAKEELQEVVSFLKKPEKFTAIGAKIPKGVL LVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIIF IDEIDAVGRQRGAGIGGGNDEREQTLNQLLTEMDGFEGNSGIIIIAATNRPDVLDVALLR PGRFDRQVTVDLPAYKGRLGILEVHARNKKLTPEISLEAIARKTPGFSGADLANMLNEAA ILTARRRKEGITPNEIDDAIDRVTIGLSLTPLLDGKKKRLIAYHELGHALLMTLLKNSDL LNKVTIIPRSGGVGGFAQPIMDEGMIDSGMYTRGWLIDRITISLGGRAAEEEIFGLAEVT VGAANDIRSVASLAREMVTRYGMSDLGPLALENPNGEVFLGRGWQSQQPEYSEEVAIKID HQIRTMVFHCYEKARKIIRENRVLMDRLVDLLIEKETIEGDEFRRIVSEYTELPKKQKSL INLEKKI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ftsH |
Synonyms | ftsH; Tery_3253; ATP-dependent zinc metalloprotease FtsH |
UniProt ID | Q10ZF7 |
◆ Recombinant Proteins | ||
ZDHHC7-2591H | Recombinant Human ZDHHC7 protein, His-tagged | +Inquiry |
TP53-5537H | Recombinant Human TP53 protein, His-tagged | +Inquiry |
CD200-212H | Recombinant Human CD200 Protein, DYKDDDDK/His-tagged | +Inquiry |
N-441S | Recombinant SARS-CoV-2 (2019-nCoV) Nucleocapsid(S194L) Protein, His-tagged | +Inquiry |
EIF2AK1-229C | Recombinant Cynomolgus Monkey EIF2AK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
PROS1-31218TH | Native Human PROS1 Protein | +Inquiry |
CTSD-26411TH | Active Native Human Cathepsin D protein | +Inquiry |
COL6A1-001B | Native Bovine COL6A1 Protein | +Inquiry |
Lectin-1722C | Native Canavalia ensiformis Lectin, Biotin conjugated | +Inquiry |
IgG-154R | Native Rabbit Immunoglobulin G | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCND2-7712HCL | Recombinant Human CCND2 293 Cell Lysate | +Inquiry |
SH3GL3-1599HCL | Recombinant Human SH3GL3 cell lysate | +Inquiry |
MAP3K14-4507HCL | Recombinant Human MAP3K14 293 Cell Lysate | +Inquiry |
ALDH1B1-16HCL | Recombinant Human ALDH1B1 lysate | +Inquiry |
SDCCAG8-1576HCL | Recombinant Human SDCCAG8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ftsH Products
Required fields are marked with *
My Review for All ftsH Products
Required fields are marked with *
0
Inquiry Basket