Recombinant Full Length Treponema Pallidum Uncharacterized Protein Tp_0675 (Tp_0675) Protein, His-Tagged
Cat.No. : | RFL12319TF |
Product Overview : | Recombinant Full Length Treponema pallidum Uncharacterized protein TP_0675 (TP_0675) Protein (O83681) (1-332aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Treponema Pallidum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-332) |
Form : | Lyophilized powder |
AA Sequence : | MNTTGRPVFPLLRRTVLKRCSLCATRCAIVFLCVLLILPFLSCCTSLSRGALPSLISHKE RMFWEIRGPQGSVYILGTISVGSEKLLHFQDKILDVFDSASRLYAELGSEDIKNFASVLQ RRMLHGMLEQENAAPTLSSLSREELEMLRSTLGDDMHTLSRFEPWVMRVALYQALIAHTK LDSGKNIEAFLYQRAGNRKILGLDSIQKHLNMLSFGNREEQITLLRALIALGKSPADFKG RLGALVRSYLSNDKTALGRVSTELDALVTKDAAGGLHRRYVAEIAASRRAAWAEEFYRLS LQHGITFVFASAGHFCGPESVFDIMRKRRLLQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TP_0675 |
Synonyms | TP_0675; Uncharacterized protein TP_0675 |
UniProt ID | O83681 |
◆ Recombinant Proteins | ||
SERPINA4-5800H | Recombinant Human SERPINA4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL28764HF | Recombinant Full Length Human Tetraspanin-11(Tspan11) Protein, His-Tagged | +Inquiry |
CALCA-13C | Recombinant Canine CALCA Protein, N-His-tagged | +Inquiry |
ANK2-1645M | Recombinant Mouse ANK2 Protein | +Inquiry |
TNFRSF11B-1162P | Recombinant Pig TNFRSF11B Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
HP-8153H | Native Human Serum Haptoglobin | +Inquiry |
SPARC-30653TH | Native Human SPARC | +Inquiry |
Lectin-1827P | Active Native Pisum Sativum Agglutinin Protein, Agarose bound | +Inquiry |
ALB-5363B | Native Bovine Albumin | +Inquiry |
Lectin-1810M | Active Native Maclura Pomifera Lectin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
THEM5-1097HCL | Recombinant Human THEM5 293 Cell Lysate | +Inquiry |
CNPY3-7396HCL | Recombinant Human CNPY3 293 Cell Lysate | +Inquiry |
LCK-681HCL | Recombinant Human LCK cell lysate | +Inquiry |
MSANTD3-7932HCL | Recombinant Human C9orf30 293 Cell Lysate | +Inquiry |
ANGPTL4-1097HCL | Recombinant Human ANGPTL4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TP_0675 Products
Required fields are marked with *
My Review for All TP_0675 Products
Required fields are marked with *
0
Inquiry Basket