Recombinant Full Length Treponema Pallidum Uncharacterized Protein Tp_0324 (Tp_0324) Protein, His-Tagged
Cat.No. : | RFL29824TF |
Product Overview : | Recombinant Full Length Treponema pallidum Uncharacterized protein TP_0324 (TP_0324) Protein (O83344) (1-485aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Treponema Pallidum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-485) |
Form : | Lyophilized powder |
AA Sequence : | MAVLPSVRRFECSLFVVLVLCALAVFDPLSGFVQQKLAGVQRVWLGLVEEYSGLRFQYDS LSPSVLRAVTLRNVRVREAVRGEQVAVFSKIVVAYNIFSLFGSNPVRGIRALHVHDGAVD VDLYRHRHVKEKLQKLFSKDGEMASFFADLREIDVRVHNTAVTVRSDSRRAHLSVPQGRF SFAETGASFALSCEAEYVDTRSSSWGPLYTHLDASGVFETSFTSGSATLELAPPSGSFFS VPTLTLVAIYADDLFKFHTARGIYPMEVSGQWNTATGACEASVRCENFRPLKWARLRDTH VPAQGMQELSVSGNVQVGYTPIEQWRWSADVHAHTPYVVLAPGYQLEDVVATLQAHGDPA RIQVEKICARGSNLDVDGAFELTLDRWIPSGVLTVHRLPLLSGAYLSAQVRFRPQGVGFV CTVPRIQVGEAFLEDVALSVRVDPAKTDFRLVAADSTGRYECDGSYLAANAGSLAFLRHT WRLNR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TP_0324 |
Synonyms | TP_0324; Uncharacterized protein TP_0324 |
UniProt ID | O83344 |
◆ Recombinant Proteins | ||
MPL-6325HF | Recombinant Full Length Human MPL Protein, GST-tagged | +Inquiry |
PSMA4-4182C | Recombinant Chicken PSMA4 | +Inquiry |
HIV2(Rod)GAGp26-132H | Recombinant HIV-2 (Rod) GAG p26 Protein, GST-tagged | +Inquiry |
RFL36208EF | Recombinant Full Length Escherichia Coli O139:H28 Monofunctional Biosynthetic Peptidoglycan Transglycosylase(Mtga) Protein, His-Tagged | +Inquiry |
HIF3A-3468HF | Recombinant Full Length Human HIF3A Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
LDH3-124H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
Lectin-1770D | Active Native Dolichos Biflorus Lectin Protein, Fluorescein labeled | +Inquiry |
HDLBP-86H | Native Human Lipoproteins | +Inquiry |
Collagen Type I-05H | Native Human Collagen Type I | +Inquiry |
C6-101H | Native Human C6 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOLR1-2103HCL | Recombinant Human FOLR1 cell lysate | +Inquiry |
C12orf54-8314HCL | Recombinant Human C12orf54 293 Cell Lysate | +Inquiry |
SLC25A3-1772HCL | Recombinant Human SLC25A3 293 Cell Lysate | +Inquiry |
COL4A3-1219RCL | Recombinant Rat COL4A3 cell lysate | +Inquiry |
Sol8-1668HCL | Sol8 (mouse myoblast) whole cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All TP_0324 Products
Required fields are marked with *
My Review for All TP_0324 Products
Required fields are marked with *
0
Inquiry Basket