Recombinant Full Length Treponema Pallidum Protein Translocase Subunit Secf(Secf) Protein, His-Tagged
Cat.No. : | RFL35824TF |
Product Overview : | Recombinant Full Length Treponema pallidum Protein translocase subunit SecF(secF) Protein (O83426) (1-420aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Treponema Pallidum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-420) |
Form : | Lyophilized powder |
AA Sequence : | MRQVVRFSLLFLPCAILSVVLIGAGVLRWALWGMSFGIDFQSGLIERLRIAPPAFSLVYT GTQSMQFFQDEQKVVFTVSSPGVLGERYEFLYTEYPTLRAFSEGAKKVEHLSVTLHAPET VYMRDTFSGAEGSTLSSASCFVHYFSEDVRAPGVEELRRVLKDVPSAVVQQVGVRAEHTF QVRVAAETAFPSSLLPEQGGTALAQSDAPDLVTPQGAVESVVYAALVRAYGADHVVRLAM DFVGSRFSHLLVRQALLLVLGALVLIFLYVALRFRWFFALGAIVALVHDACIMVSFMVWF GLEFNSASIAAILTIIGYSINDTVVVFDRVRQTILLDPIASVTTVLDRSQTDMLTRTVVT TVTTLLAALMLYVFTEGGSRDFSLALMVGMVSGVYSTIYIAGGCIALISRGKSGGQLLGL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | secF |
Synonyms | secF; TP_0411; Protein translocase subunit SecF |
UniProt ID | O83426 |
◆ Recombinant Proteins | ||
KCNJ12-3415H | Recombinant Human KCNJ12 protein, His-tagged | +Inquiry |
S-419S | Recombinant SARS-CoV-2 Spike S1 (T95I, G142D, E154K, L452R, E484Q, D614G, P681R) Protein, His-tagged | +Inquiry |
DUSP7-2946H | Recombinant Human DUSP7 Protein, GST-tagged | +Inquiry |
Mllt4-3234R | Recombinant Rat Mllt4, His-tagged | +Inquiry |
Ism1-3589M | Recombinant Mouse Ism1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
CELA1-52P | Active Native Porcine pancreatic elastase | +Inquiry |
Lectin-1782G | Active Native Griffonia Simplicifolia Lectin I isolectin B4 Protein, Biotinylated | +Inquiry |
GlycoProtein G-11H | Native HSV-2 GlycoProtein G | +Inquiry |
MARCKS-12B | Native Bovine MARCKS protein | +Inquiry |
Lectin-1797L | Active Native Lotus Tetragonolobus Lectin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
NTN5-1226HCL | Recombinant Human NTN5 cell lysate | +Inquiry |
WISP1-2820HCL | Recombinant Human WISP1 cell lysate | +Inquiry |
ADA-001HCL | Recombinant Human ADA cell lysate | +Inquiry |
MICU1-146HCL | Recombinant Human MICU1 lysate | +Inquiry |
MFN2-4347HCL | Recombinant Human MFN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All secF Products
Required fields are marked with *
My Review for All secF Products
Required fields are marked with *
0
Inquiry Basket