Recombinant Full Length Thogoto Virus Envelope Glycoprotein(P4) Protein, His-Tagged
Cat.No. : | RFL28560TF |
Product Overview : | Recombinant Full Length Thogoto virus Envelope glycoprotein(P4) Protein (P28977) (16-512aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Thogoto virus (isolate SiAr 126) (Tho) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (16-512) |
Form : | Lyophilized powder |
AA Sequence : | EPDCNTKTATGPYILDRYKPKPVTVSKKLYSATRYTTSAQNELLTAGYRTAWVAYCYNGG LVDSNTGCNARLLHYPPSRDELLLWGSSHQCSYGDICHDCWGSDSYACLGQLDPAKHWAP RKELVRRDANWKFAYHMCNIDWRCGVTTSPVFFNLQWVKNEVKVSTLLPNGSTVEHSAGE PLFWTEKDFSYLVKDNFEIQREEVKISCFVDPDYWVGERKTKKAFCQDGTNFFEVTSHQF CHQYACYNFSKDELLEAVYKERAHEKSKDLPFGNKSWTVVTASIDDLHALSAAQAFELEG LRASFAELDSRFRQLSEILDTVISSIAKIDERLIGRLIKAPVSSRFISEDKFLLHQCVDS VANNTNCVGDSAYVDGRWTHVGDNHPCTTVVDEPIGIDIYNFSALWYPSAAEVDFRGTVQ SEDGWSFVVKSKDALIQTMMYTKNGGKGTSLTDLLDYPSGWLKGQLGGLLYGNIGVYLLI AFAFVLLIRLIKSAGLC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Segment |
Synonyms | Segment; 4; Envelope glycoprotein; Surface glycoprotein 75 |
UniProt ID | P28977 |
◆ Recombinant Proteins | ||
HOXA6-13892H | Recombinant Human HOXA6, GST-tagged | +Inquiry |
NPPB-04H | Recombinant Human NT-proBNP Protein, N-6×His and C-mFc tagged | +Inquiry |
MAPK10-2491R | Recombinant Rhesus Macaque MAPK10 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL26594HF | Recombinant Full Length Human Olfactory Receptor 8H1(Or8H1) Protein, His-Tagged | +Inquiry |
TGFB1-666HF | Recombinant Full Length Human TGFB1 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
ACTN3-3280C | Native Chicken ACTN3 | +Inquiry |
PLAU-31687TH | Native Human PLAU | +Inquiry |
Lectin-1762A | Active Native Agaricus bisporus lectin Protein, Biotinylated | +Inquiry |
Lectin-1743N | Active Native Narcissus Pseudonarcissus (Daffodil) Lectin Protein | +Inquiry |
Lectin-1828P | Active Native Pisum Sativum Agglutinin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
HT-29-165H | HT-29 Whole Cell Lysate | +Inquiry |
C16orf53-8253HCL | Recombinant Human C16orf53 293 Cell Lysate | +Inquiry |
DMBT1-2407HCL | Recombinant Human DMBT1 cell lysate | +Inquiry |
RSV-F-001RCL | Recombinant RSV RSV-F cell lysate | +Inquiry |
CTBS-7214HCL | Recombinant Human CTBS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Segment Products
Required fields are marked with *
My Review for All Segment Products
Required fields are marked with *
0
Inquiry Basket