Recombinant Full Length Thiobacillus Denitrificans Undecaprenyl-Diphosphatase(Uppp) Protein, His-Tagged
Cat.No. : | RFL28216TF |
Product Overview : | Recombinant Full Length Thiobacillus denitrificans Undecaprenyl-diphosphatase(uppP) Protein (Q3SFG5) (1-276aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Thiobacillus denitrificans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-276) |
Form : | Lyophilized powder |
AA Sequence : | MADLTQILHALILGFVEGFTEFLPISSTGHLILAGQLLGFNGEKAKVFMIAIQLAAILAV VWEYRVRLRHVVSTVHTEPASRRLVVNLMAGFLPAAVLGFLFYKEIKGYLFNPIVVASAL VIGGVLILWAERRKHVVSTPTVDDLGWRRALAVGFAQALAMVPGTSRSGATIIGGLFLGL SRKAAAEFSFLLAIPTMFAATAYDLYKNWQLFDAGDIPLFAIGGVASFASALFAVRTLIK FVSRHDYTVFAWYRIVFGGVVLATAYSGLVDWGVTH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | uppP |
Synonyms | uppP; Tbd_2692; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase |
UniProt ID | Q3SFG5 |
◆ Native Proteins | ||
AK1-6667C | Active Native Chicken AK1 | +Inquiry |
F2-5285H | Native Human Coagulation Factor II (thrombin) | +Inquiry |
HP-199M | Native Monkey Haptoglobin | +Inquiry |
IgG-218D | Native Dog Immunoglobulin G | +Inquiry |
ALPI-8348B | Native Bovine ALPI | +Inquiry |
◆ Cell & Tissue Lysates | ||
Persimmon-704P | Persimmon Lysate, Total Protein | +Inquiry |
SCML1-1569HCL | Recombinant Human SCML1 cell lysate | +Inquiry |
B31-011BCL | Borrelia burgdorferi (B31 Strain) Cell Lysate | +Inquiry |
REEP2-2428HCL | Recombinant Human REEP2 293 Cell Lysate | +Inquiry |
CHERP-7541HCL | Recombinant Human CHERP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All uppP Products
Required fields are marked with *
My Review for All uppP Products
Required fields are marked with *
0
Inquiry Basket