Recombinant Full Length Sorangium Cellulosum Undecaprenyl-Diphosphatase(Uppp) Protein, His-Tagged
Cat.No. : | RFL407SF |
Product Overview : | Recombinant Full Length Sorangium cellulosum Undecaprenyl-diphosphatase(uppP) Protein (A9GC83) (1-307aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sorangium Cellulosum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-307) |
Form : | Lyophilized powder |
AA Sequence : | MFWFDAVLLGVLEGLTEFLPVSSTGHLILLGAWLGHQSEAAKTLDIVIQLGAVLAVVVYF RERLSTTVRGMVRRDPDSLRLALALAFAFLPAAVVGLLFHKAIKAHLFGPGPVAAALIVG GFLMIGVESLRRRRPDQGAPRVEDVTFQRALAIGFAQCFSLWPGASRSMTTIVGGQLSGL STAAAAEFSFLLAIPTLGAATVFDLVKNGRALLDAPGGIVALVVGLAVSFAVALLVIAVF LRYLKRYGLAPFGWYRIALGALVLWLWIASRSAPAEAGAASASPAPRGDVAAAVDGLART GDHPSRP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | uppP |
Synonyms | uppP; sce5989; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase |
UniProt ID | A9GC83 |
◆ Recombinant Proteins | ||
ADGRF5-5175H | Recombinant Human ADGRF5 Protein | +Inquiry |
SMPD1-656H | Recombinant Human SMPD1, His tagged | +Inquiry |
Acvr1c-1R | Recombinant Rat Acvr1c Protein, His (Fc)-Avi-tagged | +Inquiry |
VEGFB-640H | Recombinant Human Vascular Endothelial Growth Factor B | +Inquiry |
MED22-3490C | Recombinant Chicken MED22 | +Inquiry |
◆ Native Proteins | ||
BLA-01B | Native Bovine β-Lactoglobulin Protein | +Inquiry |
C3-01R | Native Rabbit C3 Protein | +Inquiry |
HGB-144G | Native Guinea Pig Hemoglobin protein | +Inquiry |
BCHE-26067TH | Native Human BCHE | +Inquiry |
Pepsin-41P | Active Native Porcine Pepsin | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRK-7276HCL | Recombinant Human CRK 293 Cell Lysate | +Inquiry |
THEG-1098HCL | Recombinant Human THEG 293 Cell Lysate | +Inquiry |
PLG-3109HCL | Recombinant Human PLG 293 Cell Lysate | +Inquiry |
PRRG1-2811HCL | Recombinant Human PRRG1 293 Cell Lysate | +Inquiry |
SDC1-2089MCL | Recombinant Mouse SDC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All uppP Products
Required fields are marked with *
My Review for All uppP Products
Required fields are marked with *
0
Inquiry Basket