Recombinant Full Length Thermus Thermophilus Upf0365 Protein Ttha1048(Ttha1048) Protein, His-Tagged
Cat.No. : | RFL18787TF |
Product Overview : | Recombinant Full Length Thermus thermophilus UPF0365 protein TTHA1048(TTHA1048) Protein (Q5SJG0) (1-325aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Thermus Thermophilus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-325) |
Form : | Lyophilized powder |
AA Sequence : | MEGLGIVFLAAVVLLFVFLFFSFIPVGLWISAWAAGVRVPLLTLVAMRLRRVPPAKIIYP LIKATKAGLDVRLDRLEAHYLAGGNVDRVVDALIAADKAGIKLTFDRAAAIDLAGRDVLE AVRVSVNPKVIQTPMVAAVAKDGIQLLATARVTVRANIDRLVGGAGEETIIARVGEGIVT TIGSANSHKEVLENPDRISKTVLEKGLDAGTAFEILSVDIADVDVGKNIGAQLQIDQAEA DKKIAQAKAEERRAMAVAAEQENRALVEAMRAKLVEAQAQVPLALAEALRKGHLGVMDYY RLKNIEADTDMRESISRAAKPEGEE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TTHA1048 |
Synonyms | floA; TTHA1048; Flotillin-like protein FloA |
UniProt ID | Q5SJG0 |
◆ Recombinant Proteins | ||
YBX1-5984C | Recombinant Chicken YBX1 | +Inquiry |
RGS7-5832H | Recombinant Human RGS7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CBLC-10757H | Recombinant Human CBLC, His-tagged | +Inquiry |
CRYBA1-1611R | Recombinant Rat CRYBA1 Protein | +Inquiry |
SFRP5-8086M | Recombinant Mouse SFRP5 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Ngf-182M | Active Native Mouse Ngf Protein | +Inquiry |
CA-13B | Active Native Bovine Carbonic Anhydrase | +Inquiry |
BCHE-8E | Active Native Equine Butyrylcholine esterase | +Inquiry |
ELANE-001H | Active Native Human ELANE Protein | +Inquiry |
SHBG-8259H | Native Human Serum Sex Hormone Binding Globulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
RGS5-2371HCL | Recombinant Human RGS5 293 Cell Lysate | +Inquiry |
SMARCAD1-1670HCL | Recombinant Human SMARCAD1 293 Cell Lysate | +Inquiry |
EPHA4-1192CCL | Recombinant Cynomolgus EPHA4 cell lysate | +Inquiry |
HOP62-048WCY | Human Lung Adenocarcinoma HOP62 Whole Cell Lysate | +Inquiry |
SCMH1-2033HCL | Recombinant Human SCMH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All TTHA1048 Products
Required fields are marked with *
My Review for All TTHA1048 Products
Required fields are marked with *
0
Inquiry Basket