Recombinant Full Length Thermus Thermophilus Nadh-Quinone Oxidoreductase Subunit 11(Nqo11) Protein, His-Tagged
Cat.No. : | RFL10823TF |
Product Overview : | Recombinant Full Length Thermus thermophilus NADH-quinone oxidoreductase subunit 11(nqo11) Protein (Q56226) (1-95aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Thermus Thermophilus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-95) |
Form : | Lyophilized powder |
AA Sequence : | MSYLLTSALLFALGVYGVLTRRTAILVFLSIELMLNAANLSLVGFARAYGLDGQVAALMV IAVAAAEVAVGLGLIVAIFRHRESTAVDDLSELRG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | nqo11 |
Synonyms | nqo11; TTHA0094; NADH-quinone oxidoreductase subunit 11; NADH dehydrogenase I chain 11; NDH-1 subunit 11 |
UniProt ID | Q56226 |
◆ Native Proteins | ||
IgG-012L | Native Llama Ig fraction | +Inquiry |
Thrombin-21H | Active Native Cattle Thrombin | +Inquiry |
DNase-24B | Active Native Bovine Deoxyribonuclease | +Inquiry |
Collagen Type Ⅱ-525B | Native Bovine Type Collagen Type Ⅱ Protein | +Inquiry |
IGHD -20H | Native Human IgD | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNF220-2281HCL | Recombinant Human RNF220 293 Cell Lysate | +Inquiry |
ZSCAN21-9185HCL | Recombinant Human ZSCAN21 293 Cell Lysate | +Inquiry |
CABP7-7907HCL | Recombinant Human CABP7 293 Cell Lysate | +Inquiry |
ATL2-122HCL | Recombinant Human ATL2 cell lysate | +Inquiry |
TEX30-8301HCL | Recombinant Human C13orf27 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All nqo11 Products
Required fields are marked with *
My Review for All nqo11 Products
Required fields are marked with *
0
Inquiry Basket