Recombinant Full Length Thermus Thermophilus Magnesium Transporter Mgte(Ttha1060) Protein, His-Tagged
Cat.No. : | RFL5297TF |
Product Overview : | Recombinant Full Length Thermus thermophilus Magnesium transporter mgtE(TTHA1060) Protein (Q5SMG8) (1-450aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Thermus Thermophilus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-450) |
Form : | Lyophilized powder |
AA Sequence : | MEEKLAVSLQEALQEGDTRALREVLEEIHPQDLLALWDELKGEHRYVVLTLLPKAKAAEV LSHLSPEEQAEYLKTLPPWRLREILEELSLDDLADALQAVRKEDPAYFQRLKDLLDPRTR AEVEALARYEEDEAGGLMTPEYVAVREGMTVEEVLRFLRRAAPDAETIYYIYVVDEKGRL KGVLSLRDLIVADPRTRVAEIMNPKVVYVRTDTDQEEVARLMADYDFTVLPVVDEEGRLV GIVTVDDVLDVLEAEATEDIHKLGAVDVPDLVYSEAGPVALWLARVRWLVILILTGMVTS SILQGFESVLEAVTALAFYVPVLLGTGGNTGNQSATLIIRALATRDLDLRDWRRVFLKEM GVGLLLGLTLSFLLVGKVYWDGHPLLLPVVGVSLVLIVFFANLVGAMLPFLLRRLGVDPA LVSNPLVATLSDVTGLLIYLSVARLLLEAV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TTHA1060 |
Synonyms | TTHA1060; Magnesium transporter MgtE |
UniProt ID | Q5SMG8 |
◆ Recombinant Proteins | ||
DEFB1-1829R | Recombinant Rat DEFB1 Protein | +Inquiry |
ATXN3-5928C | Recombinant Chicken ATXN3 | +Inquiry |
RFL1526EF | Recombinant Full Length Upf0410 Protein Yeaq(Yeaq) Protein, His-Tagged | +Inquiry |
A2m-02M | Recombinant Mouse A2m Protein, His-tagged | +Inquiry |
TMEM80-17081M | Recombinant Mouse TMEM80 Protein | +Inquiry |
◆ Native Proteins | ||
LAMA-69M | Native Mouse Laminin protein | +Inquiry |
Skin-008H | Human Skin Lysate, Total Protein | +Inquiry |
Thermolysin | Native Geobacillus stearothermophilus Thermolysin Protein | +Inquiry |
VTN-31737TH | Native Human VTN | +Inquiry |
IgA-240B | Native Bovine Immunoglobulin A | +Inquiry |
◆ Cell & Tissue Lysates | ||
OSBPL3-3537HCL | Recombinant Human OSBPL3 293 Cell Lysate | +Inquiry |
NAGK-428HCL | Recombinant Human NAGK lysate | +Inquiry |
HYPM-208HCL | Recombinant Human HYPM lysate | +Inquiry |
CAV2-7820HCL | Recombinant Human CAV2 293 Cell Lysate | +Inquiry |
FGFR1-1171CCL | Recombinant Cynomolgus FGFR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TTHA1060 Products
Required fields are marked with *
My Review for All TTHA1060 Products
Required fields are marked with *
0
Inquiry Basket