Recombinant Full Length Thermoplasma Volcanium Upf0290 Protein Tv0187(Tv0187) Protein, His-Tagged

• Cat.No.: RFL35862TF
• Product Overview: Recombinant Full Length Thermoplasma volcanium UPF0290 protein TV0187(TV0187) Protein (Q97CB5) (1-183aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Source: E.coli expression system
• Species: Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)
• Tag: His
• Form: Lyophilized powder
• Protein length: Full Length (1-183)
• AA Sequence: MNYPLLMAQAIILFVPALIANSGAVLTGGYFVLDRGKNFIDGRRILGDGKTLSGYLGGSF IGIVSGVIIYWISYATHFILGNYGSIALSIEIPAVMAFGSLTGDILGSFVKRRIGIKSGG KGGLLDQWPFALVAFLFLFLMERPFFLHYYFFAGIIVILAIVPPLHRAVNIIGYKLHKKD VPW
• Purity: Greater than 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: carS
• Synonyms: carS; TV0187; TVG0192666; CDP-archaeol synthase; CDP-2,3-bis-(O-geranylgeranyl-sn-glycerol synthase
• UniProt ID: Q97CB5