Recombinant Full Length Thermoanaerobacter Sp. Upf0365 Protein Teth514_1573 (Teth514_1573) Protein, His-Tagged
Cat.No. : | RFL24161TF |
Product Overview : | Recombinant Full Length Thermoanaerobacter sp. UPF0365 protein Teth514_1573 (Teth514_1573) Protein (B0K165) (1-329aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Thermoanaerobacter sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-329) |
Form : | Lyophilized powder |
AA Sequence : | MTEFIFLLVVIGLIFVFLSVILSFIPLGLWISALAAGVKIGIFTLVGMRLRRVPPDKIVK PLIKAIKAGQDVEINKLEAHYLAGGNVDKVIDALIAAQRANISLEFERAAAIDLAGRDVL HAVQMSVNPKVIETPVVAAVAKDGIEVKVKARVTVRANIDRLVGGAGEETIIARVGEGIV TTVGSSNSHKEVLENPDSISRTVLNKGLDAGTAFEILSIDIADVDVGRNIGARLQIDQAE ADKRIAQAKAEERRAMAVAREQEMKAMVQEMRAKVVEAEAEVPKAMAEALRTGKIGVMDY YNMRNVIADTMMRESFSKLGQERQQEEKE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Teth514_1573 |
Synonyms | floA; Teth514_1573; Flotillin-like protein FloA |
UniProt ID | B0K165 |
◆ Recombinant Proteins | ||
Cpt1c-837R | Recombinant Rat Cpt1c Protein, His-tagged | +Inquiry |
GMFB-2877C | Recombinant Chicken GMFB | +Inquiry |
FTL-8233C | Recombinant Cattle FTL protein, His-tagged | +Inquiry |
SPAM1-5156Z | Recombinant Zebrafish SPAM1 | +Inquiry |
BIN-1923S | Recombinant Staphylococcus aureus (strain: PM86, other: HA-MRSA) BIN protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Tenascin-112H | Native Human Tenascin | +Inquiry |
LDL-401H | Native Human Low Density Lipoprotein, Medium Oxidized, DiI labeled | +Inquiry |
Avidin Biotin-27 | Native Avidin Protein | +Inquiry |
Lectin-1829P | Active Native Pisum Sativum Agglutinin Protein | +Inquiry |
IgG-129B | Native Bovine milk Immunoglobulin G | +Inquiry |
◆ Cell & Tissue Lysates | ||
Trachea-541M | Mouse Trachea Lysate | +Inquiry |
PDHA1-001HCL | Recombinant Human PDHA1 cell lysate | +Inquiry |
CORO1A-7345HCL | Recombinant Human CORO1A 293 Cell Lysate | +Inquiry |
RDH14-2436HCL | Recombinant Human RDH14 293 Cell Lysate | +Inquiry |
NSF-3688HCL | Recombinant Human NSF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Teth514_1573 Products
Required fields are marked with *
My Review for All Teth514_1573 Products
Required fields are marked with *
0
Inquiry Basket