Recombinant Full Length Tetraodon Nigroviridis Xk-Related Protein 4(Xkr4) Protein, His-Tagged
Cat.No. : | RFL481TF |
Product Overview : | Recombinant Full Length Tetraodon nigroviridis XK-related protein 4(xkr4) Protein (Q49LS9) (1-498aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Tetraodon nigroviridis (Spotted green pufferfish) (Chelonodon nigroviridis) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-498) |
Form : | Lyophilized powder |
AA Sequence : | MAAKSDGVLKMKKSDVAFTPLQNSEHSGSVQGLHPGAQPDSAGAGDADFANGESRCCGGG GSHSTCLRLSREQQKYTVWDCLWIVAAVAVYVADVGSDVWLSVDYYLEEDYWWFGLTLFF VVLGSFSVQLFSFRWFVHDFSTEDSAEAAADGSHMDGNKLLSGSASHGDVTAQHHPATPQ RQASTASRNTTTNSTASTGLGPRGPKRPAYYTFCVWGSQSVIHILQLGQIWRYIHTIYLG VQSRQSAETERWRYYWRMVYEFADVSMLHLLATFLESAPQLVLQLCIIIQTHKLLAVQGC RLFIYYLLILAENAALSALWYLYRSPLATDAFAVPALCVIFSSFLTGVVFMLMYYAFFHP NGPRFGRSMSGHGLNLDPTAQFSTLPSEVATNSLRSNRGATATLERDAGKYSERDGCMPV FQVRPTVPSTPSSRAPRLEETVIKIDLCRNRYPAWERHVLDRSIRKAILAVDCSLTPPRL QYKDDALVQERLEYETTL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | xkr4 |
Synonyms | xkr4; xrg4; GSTENG00033649001; XK-related protein 4 |
UniProt ID | Q49LS9 |
◆ Native Proteins | ||
Thermolysin | Native Geobacillus stearothermophilus Thermolysin Protein | +Inquiry |
CKMB-165H | Active Native Human Creatine Kinase MB | +Inquiry |
S100A14-394H | Native Human S100A14 protein(Gly2-His104), His-tagged | +Inquiry |
H3N2-02I | Active Native IAV H3N2 Protein | +Inquiry |
HBsAg-321H | Active Native Hepatitis B Surface Ag Subtype Ad Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD8B-001HCL | Recombinant Human CD8B cell lysate | +Inquiry |
CPLX3-777HCL | Recombinant Human CPLX3 cell lysate | +Inquiry |
ABCD1-9149HCL | Recombinant Human ABCD1 293 Cell Lysate | +Inquiry |
VTN-2062MCL | Recombinant Mouse VTN cell lysate | +Inquiry |
MIB1-4324HCL | Recombinant Human MIB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All xkr4 Products
Required fields are marked with *
My Review for All xkr4 Products
Required fields are marked with *
0
Inquiry Basket