Recombinant Full Length Takifugu Rubripes D(2)-Like Dopamine Receptor Protein, His-Tagged
Cat.No. : | RFL4645TF |
Product Overview : | Recombinant Full Length Takifugu rubripes D(2)-like dopamine receptor Protein (P53453) (1-463aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Takifugu rubripes (Japanese pufferfish) (Fugu rubripes) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-463) |
Form : | Lyophilized powder |
AA Sequence : | MDVFTQYAYNDSIFDNGTWSANETTKDETHPYNYYAMLLTLLIFVIVFGNVLVCMAVSRE KALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWRFSKIHCDIFVTLDVMMCTASI LNLCAISIDRYTAVAMPMLYNTRYSSRRRVTVMISVVWVLSFAISCPLLFGLNNTATRDQ SLCFIANPAFVVYSSIVSFYVPFIVTLLVYVQIYVVLRKRRKRVNTKPKQRLCQAADPDI PTSLKDKCTHPEDVRLCTMIVKSNGSFPVNKKKVIFIKDGVNEVEGLELDELNYCGGSHK QPPPQQQPRALGDTPATSHQLLMSTKANASPTSTPPTPPEEGQRTEKNGDPTKEAQGNPA PVVALRNGKTQTSLKTLSKRKISQQKEKKATQMLAIVLGVFIICWLPFFITHILNTHCTR CKVPAEMYNAFTWLGYVNSAVNPIIYTTFNVEFRKAFIKILHC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | d215 |
Synonyms | d215; D(2-like dopamine receptor |
UniProt ID | P53453 |
◆ Recombinant Proteins | ||
CD83-1063H | Active Recombinant Human CD83, MIgG2a Fc-tagged | +Inquiry |
ZBTB17-5254R | Recombinant Rhesus monkey ZBTB17 Protein, His-tagged | +Inquiry |
PIWIL4-1686H | Recombinant Human PIWIL4 Protein, His (Fc)-Avi-tagged | +Inquiry |
PRSS16-4948H | Recombinant Human PRSS16 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HAO1-4570H | Recombinant Human HAO1 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
pepsin -174P | Native Pig pepsin(1:3000) active | +Inquiry |
F9-26523TH | Native Human F9 | +Inquiry |
F2-277B | Active Native Bovine α-Thrombin-BFPRck (Biotin) | +Inquiry |
Hemopexin-035B | Native Bovine Hemopexin Protein | +Inquiry |
HDL-201H | Native Human High Density Lipoprotein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLSTN2-7430HCL | Recombinant Human CLSTN2 293 Cell Lysate | +Inquiry |
SLC7A7-1639HCL | Recombinant Human SLC7A7 cell lysate | +Inquiry |
C9orf169-7938HCL | Recombinant Human C9orf169 293 Cell Lysate | +Inquiry |
CNGA2-7411HCL | Recombinant Human CNGA2 293 Cell Lysate | +Inquiry |
TCOF1-1170HCL | Recombinant Human TCOF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All d215 Products
Required fields are marked with *
My Review for All d215 Products
Required fields are marked with *
0
Inquiry Basket