Recombinant Full Length Syntrophus Aciditrophicus Atp Synthase Subunit B 1(Atpf1) Protein, His-Tagged
Cat.No. : | RFL5506SF |
Product Overview : | Recombinant Full Length Syntrophus aciditrophicus ATP synthase subunit b 1(atpF1) Protein (Q2LQZ9) (1-202aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Syntrophus aciditrophicus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-202) |
Form : | Lyophilized powder |
AA Sequence : | MKKSVWHHSLKGYCGRIAAVLCFSVLVPLVAMAAEGGGHGEEGTDWVNFGWRVLDFIILV GLFYWLLASKVKSFFSGRREEIKTTLEEARLAKEAAEHKFKEYSEKLDKASKEIEGVYEM IRAQGQAEKEKILEDARKAAAKMKEDTQARIEQELKKASQQLRMEAVQLSVHVAEDILKR NITPEDHQSMVKDYLDKVVRKH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | atpF1 |
Synonyms | atpF1; SYNAS_06280; SYN_00548; ATP synthase subunit b 1; ATP synthase F(0 sector subunit b 1; ATPase subunit I 1; F-type ATPase subunit b 1; F-ATPase subunit b 1 |
UniProt ID | Q2LQZ9 |
◆ Recombinant Proteins | ||
IL17A-113H | Active Recombinant Human Interleukin 17A | +Inquiry |
PRLR-1677H | Active Recombinant Human Prolactin Receptor, Fc-tagged | +Inquiry |
RFL4164HF | Recombinant Full Length Haemophilus Influenzae Probable Protease Sohb(Sohb) Protein, His-Tagged | +Inquiry |
FGF2-123H | Recombinant Human FGF2 Protein | +Inquiry |
PUCL-1792B | Recombinant Bacillus subtilis PUCL protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1802L | Active Native Lycopersicon Esculentum Lectin Protein, DyLight 488 Labeled | +Inquiry |
AC-63B | Native Bovine Activated Protein C | +Inquiry |
Complement C1r-45H | Native Human Complement C1r | +Inquiry |
ACTC1-852B | Native Bovine ACTC1 Protein | +Inquiry |
IgA-250M | Native Monkey Immunoglobulin A | +Inquiry |
◆ Cell & Tissue Lysates | ||
DTX3L-6792HCL | Recombinant Human DTX3L 293 Cell Lysate | +Inquiry |
FAM216A-8327HCL | Recombinant Human C12orf24 293 Cell Lysate | +Inquiry |
SEPT6-1956HCL | Recombinant Human SEPT6 293 Cell Lysate | +Inquiry |
S100A8-685HCL | Recombinant Human S100A8 cell lysate | +Inquiry |
APOBEC3G-8784HCL | Recombinant Human APOBEC3G 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All atpF1 Products
Required fields are marked with *
My Review for All atpF1 Products
Required fields are marked with *
0
Inquiry Basket