Recombinant Full Length Synechococcus Sp. Cytochrome C Biogenesis Protein Ccsb(Ccsb) Protein, His-Tagged
Cat.No. : | RFL7618SF |
Product Overview : | Recombinant Full Length Synechococcus sp. Cytochrome c biogenesis protein CcsB(ccsB) Protein (Q7U8Y8) (1-432aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Synechococcus sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-432) |
Form : | Lyophilized powder |
AA Sequence : | MKRLLVWLSDLRVAIVLLLLIALASAVGTAIPQGDPPTSYVDAYAETPWLGLLHGEQVLQ LQLDHVYSSGWFLGLLAWLGLALILCSWRRQWPALQAARRWIDYRTPRQLSKLAIAETIT CPDAEAGLTQLSAVLQRQGWELKPGLNRLAARKGVIGRVGPLLVHTGMVLLMLGAVWGAL AGNRLERFLAPDRTLDLLSPRGDSQLSITLQDFQIERDPAGRPEQFRSLLALSDSETPEE ISVNHPLRHRGITIYQADWALAAIGVQIGRSPELQLPLQTYPELGDQVWGLVLPTRPDGS EPVFLSLESEQGPVSVYDSDGSALTLLRPGGPAEEVKGLPLRVASVLPASGLLLKRDPGV PLVYLGFAVLLLGGGLSLVATRQLWAVASDGQLHVGGLCNRNLAAFAQELPLLLQRVVAR EQHDSPQSVQSS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ccsB |
Synonyms | ccsB; ccs1; SYNW0471; Cytochrome c biogenesis protein CcsB |
UniProt ID | Q7U8Y8 |
◆ Recombinant Proteins | ||
CMASB-8231Z | Recombinant Zebrafish CMASB | +Inquiry |
HA-1022I | Recombinant H1N1 (A/Michigan/45/2015) HA Protein, His-tagged | +Inquiry |
SPC24-5620H | Recombinant Human SPC24 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
N-710V | Recombinant COVID-19 N protein(P80R), His-tagged | +Inquiry |
MAG1-595T | Recombinant Toxoplasma gondii MAG1 | +Inquiry |
◆ Native Proteins | ||
APOC2-27331TH | Native Human APOC2 protein | +Inquiry |
LDL-406H | Native Human Low Density Lipoprotein, Acetylated, Biotin labeled | +Inquiry |
Adv2-10 | Native Adenovirus Type 2 Hexon Antigen | +Inquiry |
SNCA-27341TH | Native Human SNCA | +Inquiry |
Collagen-44H | Native Human Collagen I | +Inquiry |
◆ Cell & Tissue Lysates | ||
OSGIN1-1247HCL | Recombinant Human OSGIN1 cell lysate | +Inquiry |
C18orf54-8219HCL | Recombinant Human C18orf54 293 Cell Lysate | +Inquiry |
EBP-6733HCL | Recombinant Human EBP 293 Cell Lysate | +Inquiry |
SCLY-001HCL | Recombinant Human SCLY cell lysate | +Inquiry |
PDGFRA-2657HCL | Recombinant Human PDGFRA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ccsB Products
Required fields are marked with *
My Review for All ccsB Products
Required fields are marked with *
0
Inquiry Basket