Recombinant Full Length Synechococcus Sp. Cytochrome C Biogenesis Protein Ccsb(Ccsb) Protein, His-Tagged
Cat.No. : | RFL7104SF |
Product Overview : | Recombinant Full Length Synechococcus sp. Cytochrome c biogenesis protein CcsB(ccsB) Protein (Q2JXK6) (1-478aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Synechococcus sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-478) |
Form : | Lyophilized powder |
AA Sequence : | MVIPSLPLSRWLSPLRRYFRHELLPLLADLRLAIGLFLAIALLSAVGTVIEQEETVAFYQ AHYPEHPALFGFLTWRLILKLGLDHVYRTSWFLALLILFGSSLAACSLTRQWPMLKVARR WSYLTRPHSFQRLPFWTYLPQRSLQGLPQRLRQRGYAVFQDGSRLYARKGLIGRFGPILV HVSLLLILLGAIWGSLAGFKAQALIPSGSVAAIEQVTGAGDLAHLPTWQIRVNRFWIDYA PDGRVKQFYSDLSILDGGQEVKRQTISVNHPLSYRGVTLYQADWSIDSIRIRLNNSPPFQ IPVVPVPTQAGSKLWGAFVPTRPDLSEGLTLLLPDLQGTALLYDTQGQWIGSLRQGMSLA LDEVAPQRFPNRLTLHLDEVIGATGLQIKSDPGIPLVYLGFGLLMLGVAMSYFSYSQVWA LETEAGLYLGGKTNRALVSFEREFARLVEQQLLSSPPSPAKEPPPAARVGGTESLANG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ccsB |
Synonyms | ccsB; ccs1; CYA_0254; Cytochrome c biogenesis protein CcsB |
UniProt ID | Q2JXK6 |
◆ Recombinant Proteins | ||
ABCB5-150H | Recombinant Human ABCB5 protein, Trx-His-tagged | +Inquiry |
ETFDH-1007H | Recombinant Human ETFDH Protein (34-617 aa), His-SUMO-tagged | +Inquiry |
Emilin1-626M | Recombinant Mouse Emilin1 Protein, His-tagged | +Inquiry |
RFL34743EF | Recombinant Full Length Enterobacter Sp. Fumarate Reductase Subunit C(Frdc) Protein, His-Tagged | +Inquiry |
CBY1-3781HF | Recombinant Full Length Human CBY1 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
LOX3-11S | Native Soybeans LOX3 Protein | +Inquiry |
TF-102H | Native Human Transferrin (HOLO) | +Inquiry |
PMSG-01M | Native Pregnant Mare Serum Gonadotropin, Tag Free | +Inquiry |
Hb-197H | Native Human Hemoglobin | +Inquiry |
ALB-03C | Native Cynomolgus Monkey ALB protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TH-527HCL | Recombinant Human TH cell lysate | +Inquiry |
CXorf40A-7156HCL | Recombinant Human CXorf40A 293 Cell Lysate | +Inquiry |
GPRC5A-5771HCL | Recombinant Human GPRC5A 293 Cell Lysate | +Inquiry |
ANKRD10-8857HCL | Recombinant Human ANKRD10 293 Cell Lysate | +Inquiry |
NANS-3979HCL | Recombinant Human NANS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ccsB Products
Required fields are marked with *
My Review for All ccsB Products
Required fields are marked with *
0
Inquiry Basket