Recombinant Full Length Synechococcus Elongatus Photosystem Ii D2 Protein(Psbd1) Protein, His-Tagged
Cat.No. : | RFL11183SF |
Product Overview : | Recombinant Full Length Synechococcus elongatus Photosystem II D2 protein(psbD1) Protein (P11005) (1-352aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Synechococcus elongatus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-352) |
Form : | Lyophilized powder |
AA Sequence : | MTIAVGRAPAERGWFDVLDDWLKRDRFVFVGWSGLLLFPCAYLALGGWLTGTSFVTSWYT HGIASSYLEGGNFLTVAVSTPADAFGHSLMLLWGPEAQGNFVRWCQLGGLWNFVALHGAF GLIGFMLRQFEIARLVGVRPYNAIAFSGPIAVFVSVFLMYPLGQSSWFFAPSFGVAAIFR FLLFLQGFHNWTLNPFHMMGVAGILGGALLCAIHGATVENTLFEDSEQSNTFRAFEPTQA EETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSSIGIVGLALNLRAYDFVS QELRAAEDPEFETFYTKNILLNEGIRAWMAPQDQPHEKFVFPEEVLPRGNAL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbD1 |
Synonyms | psbD1; Synpcc7942_0655; psbD2; Synpcc7942_1637; Photosystem II D2 protein; PSII D2 protein; Photosystem Q(A protein |
UniProt ID | P11005 |
◆ Recombinant Proteins | ||
ANKRD17-1178HF | Recombinant Full Length Human ANKRD17 Protein, GST-tagged | +Inquiry |
AKAP12B-5656Z | Recombinant Zebrafish AKAP12B | +Inquiry |
PDLIM2-3841Z | Recombinant Zebrafish PDLIM2 | +Inquiry |
RFL19899XF | Recombinant Full Length Xanthomonas Campestris Pv. Campestris Large-Conductance Mechanosensitive Channel(Mscl) Protein, His-Tagged | +Inquiry |
NOL4L-DT-730H | Recombinant Human LOC149950 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
PNLIP-1175P | Native Porcine Pancreatic Lipase | +Inquiry |
MB-01B | Native Bovine MB Protein | +Inquiry |
MUC16-1H | Native Human MUC16 protein | +Inquiry |
HDL-398H | Native Human High Density Lipoprotein, DiO labeled | +Inquiry |
CALM3-74B | Native Bovine Calmodulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
REG3A-2691MCL | Recombinant Mouse REG3A cell lysate | +Inquiry |
CABP5-7908HCL | Recombinant Human CABP5 293 Cell Lysate | +Inquiry |
GTF2A1-762HCL | Recombinant Human GTF2A1 cell lysate | +Inquiry |
Penis-381C | Cynomolgus monkey Penis Lysate | +Inquiry |
SFTPC-1896HCL | Recombinant Human SFTPC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All psbD1 Products
Required fields are marked with *
My Review for All psbD1 Products
Required fields are marked with *
0
Inquiry Basket