Recombinant Full Length Swinepox Virus G-Protein Coupled Receptor Homolog C3 (C3L) Protein, His-Tagged
Cat.No. : | RFL31381SF |
Product Overview : | Recombinant Full Length Swinepox virus G-protein coupled receptor homolog C3 (C3L) Protein (P32229) (1-269aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Swinepox virus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-269) |
Form : | Lyophilized powder |
AA Sequence : | MSDCIFVFQIPFIVYSKLDQWIFGNILCKIMSVLYYVGFFSNMFIITLMSIDRYFAIVHP IKRQPYRTKRIGILMCCSAWLLSLILSSPVSKLYENIPHMSKDIYQCTLTNENDSIIAFI KRLMQIEITILGFLIPIIIFVYCYYRIFSTVVRLRNRRKYKSIKIVLMIVVCSLICWIPL YIVLMIATIVSLYTSNIFRHLCLYLNLAYAITFSETISLARCCINPIIYTLIGEHVRSRI SSICSCIYRDNRIRKKLFSRKSSSSSNII |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | C3L |
Synonyms | C3L; G-protein coupled receptor homolog C3 |
UniProt ID | P32229 |
◆ Recombinant Proteins | ||
CDK7-31757TH | Recombinant Human Human CDK7, His-tagged | +Inquiry |
YOAK-3564B | Recombinant Bacillus subtilis YOAK protein, His-tagged | +Inquiry |
TRIP10-5945R | Recombinant Rat TRIP10 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL1771MF | Recombinant Full Length Macaca Fascicularis Uncharacterized Protein C7Orf45 Homolog(Qtsa-20413) Protein, His-Tagged | +Inquiry |
RAB9A-3762R | Recombinant Rhesus monkey RAB9A Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Heart-005H | Human Heart Lysate, Total Protein | +Inquiry |
Complement C1q-43H | Native Human Complement C1q | +Inquiry |
ACTA1-854P | Native Porcine ACTA1 Protein | +Inquiry |
FABP-177R | Native Rabbit Fatty acid Binding Protein | +Inquiry |
Lectin-1801L | Active Native Lycopersicon Esculentum Lectin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
GTF2H2C_2-5696HCL | Recombinant Human GTF2H2D 293 Cell Lysate | +Inquiry |
TRMT61A-207HCL | Recombinant Human TRMT61A cell lysate | +Inquiry |
CD6-958RCL | Recombinant Rat CD6 cell lysate | +Inquiry |
RBM12-2480HCL | Recombinant Human RBM12 293 Cell Lysate | +Inquiry |
GYPA-749HCL | Recombinant Human GYPA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C3L Products
Required fields are marked with *
My Review for All C3L Products
Required fields are marked with *
0
Inquiry Basket